(data stored in ACNUC9543 zone)

EMBL: CP000308.PE635

CP000308.PE635       Location/Qualifiers
FT   CDS_pept        complement(723259..723927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0636"
FT                   /product="arginine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12604"
FT                   /db_xref="GOA:A0A0E1NN66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN66"
FT                   /protein_id="ABG12604.1"
FT                   /translation="MLEYIPEILKGLHTSLTLTIVSLLVALVLSVVFTIVLTLKTPIAT
FT                   PLVKIYITLFTGTPLLVQIFLIYYGPGQFPAIREYPWLWSLLSQPWLCAMIALALNSAA
FT                   YTTQLFYGAVRAIPSGQWQSCEALGMSKRQSLRILLPFAFKRALSSYSNEVVLVFKGTS
FT                   LAYTITLMEVMGYSQLMYGRTYDVMVFGAAGVVYLCVNGLLTLLMRLVERKALAFERRN
FT                   "
     atgttggaat atatacccga gatactgaaa gggctgcata ccagcctgac cttgaccatc        60
     gtctctttgc tggtggcgtt ggtgctgtca gtggtgttta ccatcgttct gacgctgaaa       120
     acccccattg ccaccccgct ggtcaaaatt tatatcacct tgttcaccgg taccccgctg       180
     ttggtacaga tctttttgat ctattacggt ccagggcaat tcccggcaat ccgcgaatat       240
     ccgtggttgt ggagtctgct gtcacagcca tggctgtgcg caatgattgc tctggcattg       300
     aacagtgcgg cgtataccac tcaactgttc tacggtgcag tacgggctat tccctctggc       360
     caatggcaat cctgtgaagc gctggggatg tcaaaacgtc aatcgttacg tattctgctg       420
     ccttttgcct ttaaacgggc gctatcatcc tattccaacg aagtggtctt ggtcttcaaa       480
     gggacctcgc tggcatacac tatcaccttg atggaggtca tggggtatag ccaactgatg       540
     tatggccgaa cctatgacgt gatggtgttt ggtgccgccg gggttgttta cctgtgcgtg       600
     aatggtttgc tgacgttgct gatgcggtta gtggagcgca aagccctggc ctttgagcga       660
     cggaattaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page