(data stored in ACNUC9543 zone)

EMBL: CP000308.PE637

CP000308.PE637       Location/Qualifiers
FT   CDS_pept        complement(724655..725386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0638"
FT                   /product="arginine-binding periplasmic protein 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12606"
FT                   /db_xref="GOA:A0A0E1NUM0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUM0"
FT                   /protein_id="ABG12606.1"
FT                   /translation="MKKLIIATVLASISLSASAAETIRFAAEATYPPFEFIDANNKMQG
FT                   FDIDLANALCKEMQADCTFTNQAFDSLIPSLKFKRFDAVISGMDITPERQKQVAFTQPY
FT                   YDNSALFIAQKDKVADLAALKGKRVGMQNGSTHQKYLMEKHPEITAVPYDSYQNAILDL
FT                   KNGRLDAVFGDTAVVNEWLKQNDQLAAVGDKVTDADYFGTGLGIAVRQSNTELQGKLDA
FT                   ALTKVKADGTYQTIYKKWFQQ"
     atgaaaaaat taataatagc gaccgtcctc gccagtatca gtttatcagc ctctgccgct        60
     gaaaccattc gtttcgctgc ggaagccact tacccaccgt tcgaatttat tgatgccaat       120
     aataaaatgc agggtttcga tatcgatctg gctaatgcac tgtgtaaaga gatgcaagcc       180
     gattgcacct ttaccaatca ggcctttgat agcttgatcc caagcctgaa attcaaacgt       240
     tttgatgccg ttatttcggg tatggacatc accccagaac gccagaaaca agtggcattc       300
     acgcagcctt actacgataa ctcagcgctg tttatcgccc aaaaagataa agtggcggat       360
     ttagccgcac tgaaaggcaa acgtgtcggt atgcagaacg gctctaccca tcaaaaatac       420
     ttgatggaaa aacaccctga aatcacggct gtgccttatg acagctacca gaatgccatc       480
     cttgacctga aaaatggccg tttggatgcc gtatttggtg ataccgcagt ggtgaatgag       540
     tggctgaaac agaatgacca attagcggcg gttggtgaca aagtgacaga cgctgactat       600
     ttcggtaccg gtttaggtat cgcggtacgc cagagcaaca ccgaattaca gggtaagtta       660
     gatgctgcgc taacgaaagt taaagccgat ggcacctatc aaactatcta taaaaaatgg       720
     ttccagcagt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page