(data stored in ACNUC9543 zone)

EMBL: CP000308.PE640

CP000308.PE640       Location/Qualifiers
FT   CDS_pept        727023..727133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5U2"
FT                   /protein_id="ABG12609.1"
FT                   /translation="MGLIGNGLGIISSYQRGQYVDHYGCLWEEVIADDVP"
     gtggggttga tagggaatgg tcttggtatc atctcttcct atcaaagagg ccagtatgtt        60
     gaccactacg gttgtctgtg ggaagaggtg atagcggatg acgtgccgtg a                111
//

If you have problems or comments...

PBIL Back to PBIL home page