(data stored in ACNUC9543 zone)

EMBL: CP000308.PE68

CP000308.PE68        Location/Qualifiers
FT   CDS_pept        82964..83227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12037"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYN5"
FT                   /protein_id="ABG12037.1"
FT                   /translation="MNIKTTVATMSILSALSFGVFAADSINENQATQLQPMGTITVSGL
FT                   NGAPSDIRQALSDKADTVGAKAYKVIEVRSENNWHATANIYK"
     atgaatatta aaacgactgt tgcaacaatg agcattctat ctgcattatc atttggtgtt        60
     tttgcagcag attctattaa tgagaatcaa gcgactcagt tgcaacctat gggaacaatt       120
     accgtcagtg gccttaatgg cgcaccatct gacatccgcc aggccttatc tgataaagca       180
     gataccgtgg gtgcgaaagc gtataaagtg attgaagtgc gttcagagaa taattggcat       240
     gccaccgcta atatttacaa ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page