(data stored in ACNUC9543 zone)

EMBL: CP000308.PE72

CP000308.PE72        Location/Qualifiers
FT   CDS_pept        complement(86934..87290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12041"
FT                   /db_xref="GOA:A0A0E1NMW2"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMW2"
FT                   /protein_id="ABG12041.1"
FT                   /translation="MRIIVYGSLRRKQGNSHWMTDAQLLGEHDLEGYEMYNLGHYPAVI
FT                   PGDGTVHCEVYRINSSIMNELDELKSNTKDYRRELIKTPYGSAWIYLYRLPTEGLPRIY
FT                   SGDWLKRHEEIDKP"
     atgcgaatta ttgtttacgg cagtttacgg cgcaaacaag ggaatagtca ttggatgacg        60
     gacgctcagt tactgggtga acatgacctt gaaggctacg aaatgtacaa tttaggccat       120
     tatccggcgg ttatccccgg agacggcact gtgcattgtg aagtttatcg gatcaactct       180
     tcaattatga atgagttaga tgagcttaaa agcaatacga aggactatcg acgtgagttg       240
     atcaagacgc cgtatggcag tgcctggata tatctgtatc gcttgccgac agagggttta       300
     ccacgcattt acagcggtga ctggctaaag cgccatgaag agattgataa gccgtaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page