(data stored in ACNUC9543 zone)

EMBL: CP000308.PE75

CP000308.PE75        Location/Qualifiers
FT   CDS_pept        93218..93856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0075"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12044"
FT                   /db_xref="GOA:Q1CBX8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBX8"
FT                   /protein_id="ABG12044.1"
FT                   /translation="MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDL
FT                   AFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPA
FT                   VISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQAMEK
FT                   AGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV"
     atgcaaaacg ttgataatac cgccgtcatt gatgcggcga atgccttgcc ggggcgactg        60
     acatcaatac cggtctctcc tctccatgcc gttcatggtc attccatgac gtatataccg       120
     gaggggatgg acctagcctt cttcgccatg ggctgcttct ggggagccga acgcttgttc       180
     tggcaacagc ctggcgtcta tagcaccgca gcaggttaca gcggtggtca cacgcctaat       240
     ccaacctatc atgaagtttg cagtggtcgt acaggccatg cggaggtggt tcgtgttgtt       300
     tttgatcccg ccgtcatcag ctatcagcag ctattgcaga ttttctggga aaatcacgat       360
     ccagcacaag ggatgcgtca gggcggtgat gtcgggacac aataccgctc ggctatttat       420
     gtcctgaccc ccgagcagga agaacaagct cacaagagcc gggagcggtt ccaacaagcc       480
     atggaaaaag ccggtgatca acgggtgatt accagcgaaa ttacggttgc cctgccgttt       540
     tactatgccg aggatgacca ccagcaatat ttgcacaaaa atcctcatgg atactgtggt       600
     cttgggggta ttggcgtttg tctgccgcct aacgtgtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page