(data stored in ACNUC9543 zone)

EMBL: CP000308.PE77

CP000308.PE77        Location/Qualifiers
FT   CDS_pept        complement(95573..95785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12046"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPQ3"
FT                   /protein_id="ABG12046.1"
FT                   /translation="MRIFQRYNPAKVAMYVKTLFRGRLYIKDMGAFEFDNGKILVPKVK
FT                   DKRHFEVMAEVNRQVLRLQADTLLT"
     atgaggatct tccagcgtta taacccggct aaagttgcca tgtatgtcaa aacgttattc        60
     cgtggtcggt tgtatatcaa agatatgggg gcttttgagt tcgataacgg taagatttta       120
     gtcccgaaag ttaaggataa gcggcatttt gaagtgatgg cggaggtcaa tcggcaggtg       180
     ttacgtttgc aggccgatac cctgctgact tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page