(data stored in ACNUC9543 zone)

EMBL: CP000308.PE78

CP000308.PE78        Location/Qualifiers
FT   CDS_pept        96121..96684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12047"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQH6"
FT                   /protein_id="ABG12047.1"
FT                   /translation="MIKNSLLIISLIFTPLLVSAHNIQDNQRVPPVGVRDKGELDYDKT
FT                   TNQFNYKNWNSSQLPGKTRVIQHIAGRTSAKEMNAPLIDAIKQANLPRERYQTTTIVNT
FT                   DDAIIGTAMFVRNSIESSKREFPWSQFIIDSKGNVAKAWGLTEKSSAIVVLDPQGNVKF
FT                   VKDGALTSAEVQQVIDQLHQLVQQ"
     atgataaaaa atagcctgct tataatatcg ctgatattca caccgctact ggtatcggcc        60
     cataacattc aggacaacca acgcgtgccg ccagttggtg tccgcgataa aggtgagttg       120
     gattatgata agaccaccaa tcagtttaac tataaaaact ggaatagctc acaattgccc       180
     ggcaaaaccc gcgtcattca acacattgct ggccgtacct cagccaaaga aatgaatgcc       240
     ccgctgattg atgccatcaa gcaagccaat ctgccacgcg aacgttacca aacgacgacc       300
     atcgtcaata ctgatgatgc aatcatcggg acagccatgt ttgtgcgtaa cagcattgaa       360
     agcagtaaac gtgaatttcc ttggtcgcaa tttattatcg acagtaaggg aaatgtggca       420
     aaagcttggg ggttaacgga gaaaagctct gccattgtgg tgctggatcc acaaggaaat       480
     gtcaaatttg taaaagatgg agcactgaca tcagcagagg tgcagcaggt catcgaccaa       540
     ctgcaccaac ttgtgcagca ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page