(data stored in ACNUC9543 zone)

EMBL: CP000308.PE83

CP000308.PE83        Location/Qualifiers
FT   CDS_pept        101712..102452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12052"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU79"
FT                   /protein_id="ABG12052.1"
FT                   /translation="MGRIAPRRRKNNRVYQPLLHSWLTIRQKVLPDAKNTDEQNLISEI
FT                   NAPEQRVDPDNVTEPALAPTQRKGVQSIKELWLKIWHLPDSFQWMEPLPFFHRRGVIIA
FT                   TTVLLLALLWPASRDNTDLSFPVSAPSTSVPLQAQLQDNNDVPVPPKVSPSETTQGNWQ
FT                   SYQVQTGKTLAQLFRDNNLPVNDVFAMAQVEGSDKPLSNLKAGQEVKIMLDAQGAVTAL
FT                   AIETPENTEVLFSRQNDGSYRREH"
     atgggcagaa tcgcgcccag gagaaggaaa aataatcggg tttatcagcc gctgctacac        60
     agttggctaa ccattaggca gaaggttcta ccggatgcaa aaaatactga tgagcaaaac       120
     ctgatatccg aaatcaatgc accagaacag agggtggatc ctgataacgt gacagaacct       180
     gcgctagcgc ccacacagag aaaaggcgtt cagagcatta aagaactgtg gctaaaaatt       240
     tggcacctgc cggacagttt tcagtggatg gagccgttgc ctttcttcca ccgccgcggg       300
     gttattatcg ctaccactgt attgctgctg gcactgctgt ggcccgcttc ccgtgataat       360
     actgaccttt ccttccccgt tagcgcccca tcgaccagcg tgccattaca ggcccaatta       420
     caagacaaca atgacgtacc cgtccccccc aaagtttccc cttctgagac gacacaagga       480
     aactggcaga gctatcaggt ccaaacgggt aaaacgttgg cgcaactgtt ccgcgataat       540
     aacctgccag tcaacgatgt ttttgccatg gctcaggtcg aaggcagcga taaaccgctg       600
     agtaacctga aggctgggca agaggtcaag atcatgctag atgcacaagg cgcagtcacc       660
     gcactggcga ttgaaacccc agagaacact gaagtgctgt tttcccgaca aaacgatggt       720
     agctatcgtc gcgaacatta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page