(data stored in ACNUC9543 zone)

EMBL: CP000308.PE84

CP000308.PE84        Location/Qualifiers
FT   CDS_pept        102592..103047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12053"
FT                   /db_xref="InterPro:IPR022231"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWC8"
FT                   /protein_id="ABG12053.1"
FT                   /translation="MMKYQLSFVLLLTPLAVFAEQHCPAIDAIKLIGGVYTAKATSGEE
FT                   WVGILQGPLPQESGIKRFSEALFVVEGENNGNNVTGSGKFQKCTYDLQAENIQLDMYYG
FT                   GTTWIASIRGKPYWEYEKGGFFEIYTCSNVAPEYCKFDILVPGSASR"
     atgatgaaat atcaattatc ctttgtgtta ctactcacgc cattggccgt atttgctgaa        60
     cagcattgtc cggcaattga tgcgattaag ctgatcggag gcgtttatac ggcgaaggcg       120
     actagtggcg aagagtgggt tggtatctta caagggccac ttccccaaga gagcggtatt       180
     aagcgtttca gtgaggcgct cttcgtggtt gaaggtgaga acaatggaaa caacgtcacc       240
     gggtcaggaa agtttcaaaa atgcacttat gatttgcaag ccgaaaacat acagctcgat       300
     atgtactatg gcggtacaac ctggatagca tccatccgtg ggaaaccata ctgggaatat       360
     gaaaaagggg gcttttttga aatttacacc tgctcaaatg tggcacctga atactgcaaa       420
     tttgatattt tagtgccagg gtcagcatct cgatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page