(data stored in ACNUC9543 zone)

EMBL: CP000308.PE86

CP000308.PE86        Location/Qualifiers
FT   CDS_pept        complement(103823..104275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0086"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12055"
FT                   /db_xref="GOA:Q1CBW7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBW7"
FT                   /protein_id="ABG12055.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEARRAELEAKLADVLAAAEARATKINELVSVTISSKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTAGEHEVHFQVHSDVFAKLNVVVVPEA"
     atgcaagtta ttctgcttga taaagtagca aacctgggca gcctgggtga ccaagttaac        60
     gtaaaagcgg gctatgctcg taacttcttg gttccacagg gtaaagctgt tccagcaaca       120
     aagaaaaacg tagagttctt tgaagcacgc cgcgctgaat tagaagccaa attggctgac       180
     gttctggctg ctgcagaagc tcgcgcaacc aaaattaacg aactggtcag cgtcactatc       240
     tcttctaaag caggggatga aggcaaactg ttcggctcta tcggtactcg cgacatcgct       300
     gacgctgtaa ctgcagctgg cgttgaagta gccaagagcg aagttcgttt gccgaatggc       360
     gttctgcgta ctgcaggtga gcatgaagtt cacttccaag tacacagcga cgtgttcgcg       420
     aaactgaacg tagttgtggt tccagaagcg taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page