(data stored in ACNUC9543 zone)

EMBL: CP000308.PE9

CP000308.PE9         Location/Qualifiers
FT   CDS_pept        7781..9649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0009"
FT                   /product="potassium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11978"
FT                   /db_xref="GOA:Q1CC44"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC44"
FT                   /protein_id="ABG11978.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
     atgagcacag agcataaaca atatttatcc gcggtgactt tggctgcaat cggggtcgtt        60
     tacggtgata ttggcaccag cccactctat accttgagag agtgtttttc tggtcattat       120
     ggttttgatg tccgacccga tgtggtgttt ggttttttat cgctgatttt ctggatgcta       180
     attctagtcg tctcggttaa atatctgacc tatgtgatgc gggctgataa cgcgggtgaa       240
     ggagggattt taacgttgat gtctttggca gggcgtaata cctcttccag agcgacgtct       300
     atcttggtgg tccttgggct aattggtggc agcttctttt atggtgaagt ggtcattacc       360
     ccggcaatct cggtgatgtc agctattgaa gggttggaaa tcgccgcacc cgcccttgat       420
     ccctacattg ttccctgctc cattgccgta ttaacgctac tttttgtgat tcaaaagcat       480
     ggcactggca gtgttggtaa acttttcgcc ccggtgatgc tggtgtggtt cctgacgtta       540
     gccttacttg gtctgcgcag tattattgct aacccagaag ttttggccgc gctgaatccc       600
     aaatgggcaa taagcttttt tgttgaatat aagtctgttt cgttttttgc ccttggtgcg       660
     gtagttctgg cgattactgg cgttgaggcg ttgtatgcgg atatggggca ttttggtaag       720
     tttcctatcc ggctcgcttg gtttactgtg gtcttaccgt cgttggtgct gaattatttt       780
     ggtcaggggg cgttattact gaaaaaccct gaagccatca aaaacccctt ctttctgcta       840
     gcccccgact gggcactgat tccattactt attctggcga cgctagccac tgttattgcc       900
     tcacaggcgg tgatttctgg cgtattttca cttactcgac aggctgttcg tttagggtat       960
     ttaccaccca tgcgaattat tcatacttca gagatggaat ctggccagat atatatccca      1020
     gtgatcaatt ggaccctcta tttagcggtg gtgttagtga ttatcggttt tgaacgctcc      1080
     agtaatttgg cggcggctta tggaatagcg gttaccggga ctatggttat caccagtatt      1140
     ctgttttgta ccgtggcatg gaaaaactgg cattggaatc gctttctcgt cgtattttta      1200
     ctgatggtct tgttgattat cgatatcccg atgttttctg ccaatgtgct taaattattc      1260
     tcagggggtt ggttgccact gtctttaggt ttggtgatgt ttattattat gaccacctgg      1320
     aaaagtgagc gtttcagttt actgcgccgt atgcatgaac acagtaattc actggaagcg      1380
     atgattgctt cactagagaa gtcaccgcca gtacgggtac ccggtacggc ggtgtatatg      1440
     tcgcgagcaa tgaatgtcat tccatttgca ttattacata accttaaaca taacaaagtg      1500
     ttacatgagc gtgttgtgtt gctaacgatg cggactgacg atgtgcctta tgtacataat      1560
     gtggagcggg ttaccatcga gcaactttct ccaaccttct ggcgggtggt tgccagatac      1620
     ggttggcgtg aaacacctaa tgtggcggaa attttccacc gttgtggttt ggaaggtttg      1680
     tcttgccaga tgatggaaac gtcgttcttt atgtcacatg aatcgctaat cctgactaag      1740
     cggccatggc acttattttt acgtggtaag ttatttattg cacttagccg taatgcatta      1800
     cgcgcaccag atcaatttga gatcccaccc aatagggtta ttgaacttgg gacacaagtg      1860
     gaaatttaa                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page