(data stored in ACNUC7421 zone)

EMBL: CP000386.PE10

CP000386.PE10        Location/Qualifiers
FT   CDS_pept        11928..12626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0010"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO5108 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02991"
FT                   /db_xref="GOA:Q1B037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B037"
FT                   /protein_id="ABG02991.1"
FT                   /translation="MTVAAVLIIFGVYSFTVILLYDGEYREYLSPFYSPQVGLPEWVPG
FT                   FITAPMFVLWIPLGFRATCYYYRKAYYRAFFWDPPACLAGAQKREPRSPESYRGERALF
FT                   VINNVHRYFLYGSWVILAFLWYDTVLTFFPPEGGFQVKVGSLIWLANVVLLSMYSFSCH
FT                   SMRHVVGGNKDCYTCIRGGNARRRLYNAVSRQNAHHPTWAWLSLFSVLFTDIYLRLIAA
FT                   GVIPDLTIIG"
     atgaccgtcg ccgccgtact gatcatattc ggcgtttact ctttcacggt catcctgctc        60
     tacgacgggg agtaccggga gtacctctcg cccttctact cgccgcaggt ggggctgccg       120
     gagtgggtgc cgggcttcat cacggcgccg atgttcgtgc tgtggatacc cctgggcttc       180
     agggccactt gctactacta ccgcaaggcc tactaccggg ccttcttctg ggatcctccg       240
     gcgtgcctgg ccggggcgca gaagcgcgag ccgcgcagcc cagagagcta ccggggggag       300
     cgcgcgctct tcgtgataaa caacgtccac cggtactttc tgtacggctc ctgggtcatc       360
     ctggcctttc tctggtacga caccgtgctc accttcttcc cgccggaggg agggtttcag       420
     gtgaaggtgg gctccctcat ctggctggcc aacgtggtgc tgctctccat gtacagcttc       480
     tcgtgccact ccatgcgcca cgtcgtcggg gggaacaagg actgctacac ctgcatccgc       540
     gggggcaacg cgcggcgcag gctgtacaac gcggtgagcc ggcagaacgc ccaccatccc       600
     acctgggcct ggctcagcct cttctccgtg cttttcaccg atatatactt gaggctcata       660
     gcagctggcg ttatccccga cctcacgatc atagggtag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page