(data stored in ACNUC7421 zone)

EMBL: CP000386.PE101

CP000386.PE101       Location/Qualifiers
FT   CDS_pept        107722..109641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0103"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like PAS fold-3 PAS fold-4 PAS fold; SMART: PAS
FT                   PAC motif; KEGG: gsu:GSU2388 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03082"
FT                   /db_xref="GOA:Q1AZU6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU6"
FT                   /protein_id="ABG03082.1"
FT                   /translation="MDPSSLQGYQPLVFYAAAAVAGALLAGLAALLLWRRGRPSRRRDA
FT                   LRAAAFEQAAEGMLLVSGDRVLEANAACAALLGRERGELAGMPLGELLAGGAGGVPLPP
FT                   GKRSWSGTLALRSGGGEPVECEAAASRVLAGGREAVCLALRDVTERRREEEKLRETESR
FT                   YRTLVEQVPAIVYIEDVQTQATLYDSPRIEEILGYPRDLCEREPLYWHRILYPEDRERV
FT                   LEAEREAVERGSFVLEYRVFAADGRVVWVRDEARLLRDESGEPRFWQGVISDITEQRRA
FT                   EDALRESEERYRSLVQLSPDGVAVESEGRFVYLNEAGARLLGASSPQEVLGQPVMERVH
FT                   PDCRENARRRARRLRRGERVELQEERWLRLDGREMDVEVSAAPVQYGGRPSAQLVLRDV
FT                   TGRKRAEREIVRQKAELARSNAELEQFAYLIAHDLRAPLRSMDGFAQILLEDCAPRLGP
FT                   DGREYLARIQRATRKMARMIDELLGLSRLARADIRREPVDLSAMARSIGEELRQGEPDR
FT                   RVEFIVAGGLAAEGDRRLLRVALANLLENAWKFTRRTPRPRIVFGRIERGGERVFFVRD
FT                   NGVGFDMAYAGKLFGPFQRLHAEEEFEGTGIGLAAVARVIERHGGRVWAEGAEGEGATF
FT                   YFTL"
     atggacccga gcagcttgca gggctaccag ccgctcgtct tctacgcggc ggcggccgtc        60
     gcgggcgccc tgctggccgg gcttgcggcc ctcctcctgt ggcgccgcgg gcgcccgtct       120
     cgaaggaggg acgccctgcg cgcggccgcc ttcgagcagg cggcggaggg gatgctgctc       180
     gtctcggggg accgggtgct ggaggcgaac gccgcctgcg ccgccctgct cggcagggag       240
     cgcggggagc ttgcggggat gcccctcggg gagctcctcg ccggcggggc cgggggtgtg       300
     cctctgccgc ccggcaagcg cagctggtcg gggacgctcg ccctgaggtc cggcgggggc       360
     gagcccgtgg agtgcgaggc ggcggcgagc cgggtgctcg ccggcggccg ggaggcggtg       420
     tgcctcgcgc tgcgggacgt cacggagcgg cggcgcgagg aggagaagct gcgggagacc       480
     gagtcccgct accggacgct cgtcgagcag gtgcccgcca tcgtctacat cgaggacgtg       540
     cagacgcagg ccaccctcta cgacagcccg cggatagagg agatcctggg ctacccgcgg       600
     gacctctgcg agcgcgagcc cctctactgg caccgcatcc tctaccccga ggaccgcgag       660
     cgggtgctgg aggccgagcg ggaggcggtc gagcggggca gctttgtcct ggagtaccgg       720
     gtctttgccg ccgacggccg ggtggtgtgg gtccgggacg aggcccgcct cctgcgcgac       780
     gagtcgggcg agccccgctt ctggcagggt gtgatctcgg acatcaccga gcagcggcgg       840
     gcggaggacg cgctgcggga gagcgaggag cgctaccgct cgctggtgca gctctccccg       900
     gacggggtgg cggtggagag cgaggggcgc tttgtctacc tgaacgaggc gggggcccgc       960
     ctgctggggg cctcctcccc gcaggaggtg ctcggccagc cggtcatgga gcgggtgcac      1020
     ccggactgcc gggagaacgc ccgccgccgc gcccggcgcc tccggcgggg cgagcgcgtg      1080
     gagctgcagg aggagcgctg gctccgcctg gacggtcggg agatggacgt ggaggtctcc      1140
     gcggcgccgg tgcagtacgg ggggcggccc tccgcccagc tggtgctccg ggacgtcacc      1200
     ggcaggaagc gcgccgagcg ggagatcgtc cgccagaagg cggagcttgc ccgctccaac      1260
     gcggagctgg agcagttcgc ctacctgatc gcccacgacc tccgcgcccc gctccggagc      1320
     atggacggct tcgcccagat cctgctggag gactgcgccc cccggctcgg ccccgacggc      1380
     cgggagtacc tcgcgcgcat ccagcgcgcc acccgcaaga tggcccggat gatcgacgag      1440
     cttctcggcc tctcccggct cgcccgcgcg gacatccggc gcgagccggt ggacctctcg      1500
     gccatggccc gctccatcgg cgaggagctg cggcaggggg agcccgaccg ccgggtggag      1560
     ttcatcgtcg cgggcgggct cgccgccgag ggcgaccgcc gcctgctgcg ggtcgccctc      1620
     gccaacctcc tggagaacgc ctggaagttc acccgccgca ccccccgccc ccgcatagtc      1680
     ttcggccgca tagagcgcgg cggagagcgc gtcttcttcg tccgggacaa cggggtcggc      1740
     ttcgacatgg cctacgccgg caagctcttc ggccccttcc agcggctgca cgccgaggag      1800
     gagttcgagg ggaccggcat cgggctcgcc gccgtcgccc gcgtcataga gcgccacggc      1860
     ggccgggtct gggccgaggg cgccgaaggg gagggggcga ccttctactt caccctataa      1920
//

If you have problems or comments...

PBIL Back to PBIL home page