(data stored in ACNUC7421 zone)

EMBL: CP000386.PE102

CP000386.PE102       Location/Qualifiers
FT   CDS_pept        109681..110130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0104"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: bte:BTH_II1567 universal stress
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03083"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU5"
FT                   /protein_id="ABG03083.1"
FT                   /translation="MGAFPTRILLATDGSPDAERAGRVAVDLANSTGSELHVVTVARGL
FT                   DPAYFVHEYYYGFQEALEAFEEEARQVLEEQVRKLEEYGGRVAGAHLLTEQPKDRAIVR
FT                   LSEELGAGLIVMGSRGRGGLRRALMGSVSDSVVRHAHCPVLIVRS"
     gtgggtgctt ttccgacgag gatcctcctg gctaccgacg gctcgccgga cgccgaaagg        60
     gccggtcggg tggcggtgga cctcgccaac agcacgggct ccgagctgca cgtggtgacg       120
     gtcgcccgcg ggctggaccc ggcctacttc gtgcacgagt actactacgg gttccaggag       180
     gcgctggagg ccttcgagga ggaggcccgc caggtgctcg aggagcaggt cagaaagctg       240
     gaggagtacg gcggcagggt cgccggggcg cacctgctca ccgagcagcc caaggaccgc       300
     gccatcgtcc ggctgagcga ggagctcggc gccggcctca tcgtcatggg aagccgcggc       360
     cgcggcggcc tccgccgcgc cctcatgggc agcgtctccg actccgtcgt ccgccacgcc       420
     cactgccccg tcctcatcgt ccgcagctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page