(data stored in ACNUC7421 zone)

EMBL: CP000386.PE114

CP000386.PE114       Location/Qualifiers
FT   CDS_pept        121996..122310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0116"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   ade:Adeh_3104 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03095"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT3"
FT                   /protein_id="ABG03095.1"
FT                   /translation="MNPVVERVARWREEDKRCALATVVKVERSGPLGPGTSMAVSEDGE
FT                   VVGSVSGGCVEPAVYEEAMSAIQTGEPRLLTYGISDEEAFGVGLTCGGVIHIFVERVDW
FT                   "
     atgaacccgg tggtggagag ggtcgctcgg tggcgcgagg aggacaagag gtgcgccctg        60
     gccacggtgg tcaaggtcga gcgctcgggg cctttggggc cgggcacctc gatggctgtc       120
     agcgaggacg gcgaggtggt gggctcggtc agcgggggct gcgtggagcc ggccgtctac       180
     gaggaggcca tgagcgccat ccagaccggc gagcccaggc tcctcaccta cggcatctcc       240
     gacgaggagg ccttcggggt ggggctcacc tgcggcgggg tgatccacat cttcgtcgag       300
     agggtggact ggtag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page