(data stored in ACNUC7421 zone)

EMBL: CP000386.PE116

CP000386.PE116       Location/Qualifiers
FT   CDS_pept        123110..123733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0118"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; KEGG: sco:SCO6244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03097"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT1"
FT                   /protein_id="ABG03097.1"
FT                   /translation="MSGVFGVLLAAGEGSRFGGGKLLAPFRGRPLVEHALLALREAPLE
FT                   GAVAVVGEGDAEGVRRLCGEHGVRVVENPRWREGQSTSVLAGIGALGPEARAAVVLLGD
FT                   QPLVGAGAVDRLVRAFEEGAKIAAATYAGRVRNPVLFAREVWPLLEEELAGDEGARRVL
FT                   RRHPGLVRRVPCDGVGDPADVDTREDLRRLEERAARGERRLPAR"
     gtgagcgggg tcttcggggt gctgctcgcc gccggggagg ggagccgctt cgggggcggg        60
     aagctgctcg cccccttccg ggggcggccg ctggtggagc acgcgctcct cgcgctgcgg       120
     gaggccccgc tggagggggc cgtggcggtg gtgggggagg gggatgcgga gggggtgcgc       180
     cggctgtgcg gggagcacgg ggtgcgcgtg gtggagaacc cccgctggcg ggaggggcag       240
     tccacctccg tgctcgccgg gatcggggcg ctcgggccgg aggcccgggc ggcggtcgtc       300
     ctgctcggcg accagccgct cgtgggggcc ggggcggtgg accggctcgt ccgggccttc       360
     gaggaggggg cgaagatagc ggcggccacc tacgccggga gggtgcgcaa cccggtgctc       420
     ttcgcccggg aggtctggcc gcttttggag gaggagctcg cgggggacga gggtgcccgg       480
     cgcgtgctgc ggcgccaccc cgggctggtg cgccgggtgc cgtgcgacgg cgtcggggac       540
     ccggccgacg tggacaccag ggaggatctg cggcggctcg aggagcgggc cgcgcgggga       600
     gagaggaggt tgccggcgcg atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page