(data stored in ACNUC7421 zone)

EMBL: CP000386.PE117

CP000386.PE117       Location/Qualifiers
FT   CDS_pept        123730..124173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0119"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mtc:MT0384.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03098"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT0"
FT                   /protein_id="ABG03098.1"
FT                   /translation="MKLENEFRVSSPVQKVWEALLDLERVTPCLPGAALTEQAGDHYKG
FT                   TMAVKLGPVTARYSGTVRFVETDERARRAVIEAKGRDVRGQGTASATITSTLHEEEGER
FT                   TRVVVRTEMRLTGRVAQFGRGIQQDVASKIMDRFASCLENEVF"
     atgaagcttg agaacgagtt cagggtgagc tctccggtgc agaaggtgtg ggaggcgctc        60
     ctggacctgg agagggtgac cccctgcctg cccggagcgg ccctcaccga gcaggcaggg       120
     gatcactaca aagggaccat ggccgtaaag ctgggcccgg tcaccgcccg ctacagcggg       180
     acggtgaggt ttgtggagac cgacgagcgg gcgaggcggg cggtcataga ggccaagggg       240
     cgggacgtga gggggcaggg gacggcctct gcgaccatca cctccacgct gcacgaggag       300
     gagggggaga ggacgagggt ggtggtgcgg acggagatgc gccttacggg gcgtgtggcg       360
     cagtttggga ggggcataca gcaggatgtg gcgagcaaga tcatggaccg cttcgcctcc       420
     tgccttgaga acgaggtctt ctag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page