(data stored in ACNUC7421 zone)

EMBL: CP000386.PE118

CP000386.PE118       Location/Qualifiers
FT   CDS_pept        124189..124827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0120"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mtc:MT0384.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03099"
FT                   /db_xref="GOA:Q1AZS9"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS9"
FT                   /protein_id="ABG03099.1"
FT                   /translation="MRIENEFTVGVPVEEAWRALQNLEEVAPCLPGASVEGSEGEEYRG
FT                   TMTVKLGPITARYNGTVRYAEVDEANRRMVLQASGRDARGQGTASATITSTLSGRDGST
FT                   HVRVETDMRLTGRAAQFGRGIQQDVATKMLGQFAECLERKLSGEPEEAAAPQEEEQQVR
FT                   VRRIQQPEPEPLDLGEMGREAVAERLKQAAPAIAAGAALLLLIFWLLRR"
     atgaggatag agaacgagtt caccgtcggc gtgcccgtcg aggaggcctg gagggcgctg        60
     cagaacctgg aggaggtcgc gccctgcctg cccggggcct ccgtggaggg ctccgagggc       120
     gaggagtaca ggggcaccat gaccgtaaag ctcggcccga tcaccgcccg ctacaacggg       180
     acggtccgct acgcggaggt cgacgaggcg aaccggcgaa tggtcctgca ggccagcggg       240
     cgggacgcga gggggcaggg gacggcctct gcgaccatca cctccacgct gagcgggcgg       300
     gacggcagca cccacgtccg ggtggagacg gacatgcggc tcaccgggcg ggcggcccag       360
     ttcgggcggg gcatacagca ggacgtggcc accaagatgc tcggccagtt cgccgagtgc       420
     ctggagcgca agctctccgg tgagccggag gaggccgccg ccccgcagga ggaggagcag       480
     caggtgcggg tgcgcaggat ccagcagccc gagccggagc cgctggacct cggggagatg       540
     ggccgggagg cggtcgccga gcgcctcaag caggccgccc ccgccatcgc agcgggggcg       600
     gcgctgctgc tcctgatctt ctggctcttg cgccggtag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page