(data stored in ACNUC7421 zone)

EMBL: CP000386.PE12

CP000386.PE12        Location/Qualifiers
FT   CDS_pept        14396..15214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0012"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mbo:Mb0253c probable succinate dehydrogenase [iron-sulfur
FT                   subunit] (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02993"
FT                   /db_xref="GOA:Q1B035"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B035"
FT                   /protein_id="ABG02993.1"
FT                   /translation="MSDGNVTSRAHAPVGEEGLGGTGRTAKLKIFRGDASGGEEVEYEI
FT                   PLVEGMVILDAVLYIQAHQANDLAVRWNCKAAHCGSCSAEINGIPRLMCKTRVEEFEGR
FT                   EIHVGPMRAFPVIKDLVSDVSWNYEVSSKITPFTTSQKAPFTMYEEDVERLYEPKKCIE
FT                   CFMCQDVCHVLRTHHKHPEFAGPRFFVRNQWLEMHPMDEADRLGDLKEKNGLGYCNITK
FT                   CCTEVCPVGIKITDNSIIPLKERVADEYYDPARWLMRKIQGRRNGGRNGS"
     atgagcgacg gcaacgttac ctccagggct cacgcgccgg tcggcgagga ggggctcggg        60
     ggcaccggca ggacggctaa gctcaagatc ttccgcggcg acgccagcgg gggcgaggag       120
     gtggagtacg agatccccct cgtggagggg atggtcatcc tcgacgccgt gctctacatc       180
     caggcccacc aggcgaacga cctggcggtg cgctggaact gcaaggccgc gcactgcggc       240
     tcgtgcagcg ccgagataaa cggcatcccg cgcctgatgt gcaagacgcg ggtcgaggag       300
     ttcgagggca gggagatcca cgtggggccc atgcgggcct tccccgtgat caaggacctg       360
     gtctccgacg tctcctggaa ctacgaggtc tcgagcaaga tcacgccgtt caccacgagc       420
     cagaaggcgc ccttcacgat gtacgaggag gacgtggagc gcctctacga gccgaagaag       480
     tgcatcgagt gctttatgtg ccaggacgtc tgccacgtgc tgcgcacgca ccacaagcac       540
     ccggagttcg ccggcccgcg ctttttcgtg cgcaaccagt ggctggagat gcaccccatg       600
     gacgaggccg accggctggg cgacctcaag gagaagaacg gcctcggcta ctgcaacatc       660
     accaagtgct gcaccgaggt gtgcccggtc ggcatcaaga tcaccgacaa ctccatcatc       720
     cccctcaagg agcgcgtcgc cgacgagtac tacgacccgg cccgctggct gatgcgcaag       780
     atccagggcc gcaggaacgg cggccgcaac gggtcgtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page