(data stored in ACNUC7421 zone)

EMBL: CP000386.PE126

CP000386.PE126       Location/Qualifiers
FT   CDS_pept        complement(132093..133004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0128"
FT                   /product="respiratory-chain NADH dehydrogenase, subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: pca:Pcar_0210 NADH dehydrogenase I, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03107"
FT                   /db_xref="GOA:Q1AZS1"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS1"
FT                   /protein_id="ABG03107.1"
FT                   /translation="MGDGAVSALAVLAALLAGAYLVAVLEGWSATGRLRPAGPAVSAAA
FT                   LLGRESVVPRRPDRVLFEAAPLLLLVSAVLAAAVLPLSPRLVVADLATGALFVNAALAY
FT                   VMVALLMAGWGPDAAYAMVAGWRFLGQLLGYSMPIVMAIAAIAMRAESLRNTEVVASQA
FT                   ALPNALYQPVGFAVFFLAAMCLAFLPPFDLPTAPGELAGGVEAEYAGARLAVMRLGRMV
FT                   LVVALSAAVTVFYLGGWLGPALPPWAWSAIKTLAVAAAMLLAGRYVPRLREAQVLAWWW
FT                   KLGIPLALLNIFWVGVVLLVAE"
     gtgggagacg gcgcggtgag cgcgctcgcg gtgcttgccg cgctgctggc cggcgcctac        60
     ctcgtcgcag tgctcgaggg gtggtcggcg accgggcggc tgcggcccgc cggcccggcg       120
     gtctcggcgg cggctctcct cgggcgcgag tccgtcgtcc cgcgcaggcc cgaccgcgtc       180
     ctcttcgagg ccgccccgct gctgctgctc gtctcggcgg tgctcgccgc cgccgtgctg       240
     cccctcagcc cgcgcctcgt cgtcgccgac ctcgccacgg gcgcgctctt cgtgaacgcg       300
     gcgctggcct acgtgatggt cgcgctcctc atggccgggt ggggcccgga cgccgcctac       360
     gcgatggtcg ccggctggcg cttcctcggg cagctcctcg gctactccat gcccatcgtc       420
     atggccatag ccgccatcgc catgcgcgcc gaatcgctca ggaacaccga ggtcgtggcg       480
     tcgcaggccg ccctcccgaa cgccctctac cagccggtgg gcttcgccgt gttctttctg       540
     gcggcgatgt gcctggcctt cctgccgccc ttcgacctgc ccaccgcccc cggcgagctc       600
     gcgggcgggg tcgaggccga gtacgccggg gcgcggctgg cggtgatgcg cctggggcgc       660
     atggtgctgg tggtcgcgct ctcggcggcg gtgacggtct tctacctggg cgggtggctc       720
     ggccccgcgc tgccgccctg ggcgtggagc gccataaaga cgctcgccgt ggccgccgcc       780
     atgctgctcg ccgggcggta cgtgccgcgg ctgcgcgagg cgcaggtgct cgcgtggtgg       840
     tggaagctcg gcatcccgct cgcgctcctg aacatcttct gggtgggcgt cgtgctgctg       900
     gtggcagagt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page