(data stored in ACNUC7421 zone)

EMBL: CP000386.PE131

CP000386.PE131       Location/Qualifiers
FT   CDS_pept        complement(135515..137770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0133"
FT                   /product="ATPase, P type cation/copper-transporter"
FT                   /note="TIGRFAM: ATPase, P-type,
FT                   K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter ATPase, P type
FT                   cation/copper-transporter Heavy metal translocating P-type
FT                   ATPase; PFAM: Haloacid dehalogenase-like hydrolase Heavy
FT                   metal transport/detoxification protein E1-E2
FT                   ATPase-associated region; KEGG: ana:alr7635
FT                   cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03112"
FT                   /db_xref="GOA:Q1AZR6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR6"
FT                   /protein_id="ABG03112.1"
FT                   /translation="MGEGARRTSFRVTGMSCAACASRVQKALGRVPGVVEANVNLATER
FT                   ATVEHGPEAGMEELRRAVEKAGYGVALEEDTGEGREREYRGLRRDLLVAGAFTALIVLG
FT                   SLPHMLGLAPPVPMGVLNLVLLALATPVQFWAGRRFYRGAWSALRHGQANMNTLVALGT
FT                   SAAYLYSLAATLAPGLFAGRAGVYFDTSAIIITLVLLGRLLEARARGRTSEAIKKLAGM
FT                   QARTARVVRGGEEADIPVEEVAVGDTVVVRPGEKVPVDGVVIAGRSAVDEAMITGESVP
FT                   AEKGPGDEVIGGTINRTGSFRLRATRVGRDTALARIVRLVEEAQGSKAPIQRLADRISG
FT                   VFVPVVMVVAGLTFLIWWAFGPEPAFTHALLNMVAVLIIACPCAMGLATPTSIMVGTGR
FT                   GAERGILIKGGEALEEAHRTTTVVLDKTGTLTKGEPRLTDVVPAGGLAGEELLRLAAAA
FT                   ESASEHPLGEAVVAGARERGLALPSPEDFEAPTGLGVRATVEGRTVLVGSRSLMRESGV
FT                   QEDGLAPRAEALSREGKTPILVAVDGEPAGLLAVADTIREEAEEAVELLHRMGLEVVMM
FT                   TGDNRFAAEAVAGRLGIDRVLAGVMPQDKAGKVRELQEEGRKVAMVGDGINDAPALAQA
FT                   DVGIAIGTGTDVAMEAADITLVGGDVRGVARAIKLSKATIRNIRQNLFWAFAYNVALIP
FT                   VAAGALYPLFSGGTVPEALRPILGEYGFLNPALAAAAMALSSVTVVSNALRLRRVRL"
     atgggcgagg gcgcgagaag gacgtctttc cgggtgaccg gcatgagctg cgcggcctgc        60
     gcgagccggg tgcagaaggc gctcgggcgg gtgccgggcg tggtggaggc gaacgtcaac       120
     ctggcgaccg agcgggccac ggtggagcac ggtcccgagg cggggatgga ggagctgcgg       180
     cgggccgtgg agaaggccgg gtacggggtg gcccttgagg aggataccgg ggaggggagg       240
     gaacgggagt accgggggct gaggcgggat cttctcgtgg ccggggcgtt cacggcgctc       300
     atcgtgctcg ggagcctgcc gcacatgctc ggcctcgcgc cgccggtacc catgggggtt       360
     ctcaacctcg tgctgctcgc tctggcgacg ccggtgcagt tctgggccgg gcggcggttc       420
     taccgggggg cctggagcgc cctgaggcac ggccaggcca acatgaacac gctggtcgcg       480
     ctgggcacca gcgcggccta cctctacagc ctcgcggcga cgctcgcgcc gggcctgttc       540
     gcggggcggg ccggggtgta cttcgacacc tcggcgatca tcataacgct cgtcctcctg       600
     ggcaggctgc tcgaggcgcg ggcgcggggg aggacgagcg aggccataaa gaagctcgcc       660
     gggatgcagg cccggaccgc ccgcgtggtg cgcggcgggg aggaagccga catccccgta       720
     gaggaggtcg cggtcgggga caccgtggtg gtcaggccgg gggagaaggt gccggtggac       780
     ggcgtggtga tcgcgggccg ctccgcggtg gacgaggcca tgatcacggg ggagagcgta       840
     ccggcggaga agggtccggg ggacgaggtc atcgggggca ccatcaaccg caccggctcc       900
     ttccgcttgc gggccaccag ggtcggcagg gacacggcgc tcgcccggat cgtgcgcctg       960
     gtcgaggagg cgcagggttc caaggccccc atccagcggc tcgccgacag gatcagcggc      1020
     gtcttcgtcc ccgtcgtgat ggtcgtcgcg gggctcacct tcctcatctg gtgggccttc      1080
     gggcccgagc cggcgttcac ccacgccctg ctcaacatgg tcgcggtgct catcatcgcc      1140
     tgcccgtgcg ccatggggct cgcgaccccc acctccataa tggtcggcac cggcaggggc      1200
     gccgagcgcg gcatcctcat aaagggcggc gaggcgctgg aggaggcgca caggaccacg      1260
     accgtcgtgc tggacaagac cggcaccctc accaagggcg agccgcgcct caccgacgtg      1320
     gtccccgccg gcgggctcgc cggggaggag cttttgcggc tcgccgcggc cgccgagagc      1380
     gccagcgagc accctctggg cgaggcggtg gtggccggcg cgagggagcg cggcctcgcc      1440
     ctcccctccc ccgaggactt cgaggccccc accgggctcg gcgtgcgggc caccgtcgag      1500
     ggccggacgg tgctcgtcgg gagccgcagc ctcatgcggg agagcggggt gcaggaggac      1560
     gggctcgcgc cgcgcgccga ggccctctcc cgcgagggca agacccccat cctcgtggcg      1620
     gtcgacggcg agccggccgg gcttctggcc gtcgccgaca ccataaggga ggaggccgaa      1680
     gaggccgtgg agctgctcca ccgcatgggg ctcgaggtcg tgatgatgac cggcgacaac      1740
     cgcttcgcgg cggaggccgt ggccggaagg ctcggcatag accgggtgct cgccggggtg      1800
     atgccccagg acaaggcggg caaggtcagg gagctgcagg aggagggcag aaaggtcgcc      1860
     atggtgggcg acggcatcaa cgacgccccg gcgctcgcgc aggcagacgt cggcatcgcc      1920
     ataggcaccg gtacggacgt ggcgatggag gccgcggaca taaccctcgt cgggggcgac      1980
     gtacggggtg tggcgcgggc tataaagctc tccaaggcca ccatcaggaa catccgccag      2040
     aacctcttct gggccttcgc ctacaacgtg gccctcatcc cggtagcggc gggcgcgctc      2100
     taccccctct tctccggcgg cacggtgccg gaggcgctgc gccccatcct gggcgagtac      2160
     gggttcctca acccggcgct cgcagcggcg gcgatggcgc tctcgtcggt gacggtggtg      2220
     agcaacgcgc tcaggctccg gcgggtgagg ctctag                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page