(data stored in ACNUC7421 zone)

EMBL: CP000386.PE140

CP000386.PE140       Location/Qualifiers
FT   CDS_pept        146784..147224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0142"
FT                   /product="OsmC-like protein"
FT                   /note="PFAM: OsmC-like protein; KEGG: sco:SCO6531 putative
FT                   ATP/GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03121"
FT                   /db_xref="GOA:Q1AZQ7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ7"
FT                   /protein_id="ABG03121.1"
FT                   /translation="MAAERRAEAVWEGNLVQGSGRFTVGSGAFGEMPVTWASRTEKPDG
FT                   KTSPEELIAAAHASCFAMALSFVLGEGGNPPERLEVSATSTFEEADGGFRISRMQLDVR
FT                   GRVPGLDEEGFRSAVEQAEQGCPVSNALRGNVDISVSARLEG"
     atggctgcgg agcgcagggc ggaggcggtc tgggaaggga acctcgttca gggcagcggc        60
     aggttcacgg tgggcagcgg cgccttcggc gagatgccgg tcacctgggc gtcgcgcacc       120
     gagaagccgg acgggaagac cagccccgag gagctgatcg cggcggccca cgcctcgtgc       180
     ttcgccatgg ccctctcctt cgtgctcggc gaggggggca accccccgga gcgcctggag       240
     gtcagcgcca cctccacctt cgaggaggcc gacgggggtt tcaggatctc ccggatgcag       300
     ctcgacgtga gggggcgggt ccccgggctc gacgaagagg gcttccgcag cgccgtggag       360
     caggccgagc agggctgccc ggtcagcaac gccctgcgcg gcaacgtgga catcagcgtg       420
     agcgcccgcc tggagggcta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page