(data stored in ACNUC7421 zone)

EMBL: CP000386.PE142

CP000386.PE142       Location/Qualifiers
FT   CDS_pept        complement(148866..149180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0144"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   oih:OB2443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03123"
FT                   /db_xref="GOA:Q1AZQ5"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ5"
FT                   /protein_id="ABG03123.1"
FT                   /translation="MSREEEWVRVERTQAFKELMRQKKAFIIPATIFFVIFYFGLPVLT
FT                   GFTTLLDAQVIGSISLAYLYAFAQFAMTWILMHLYLSRANRWDELVDRARRQAAEGEVS
FT                   "
     ttgagcaggg aagaggaatg ggttcgcgtc gagaggacgc aggccttcaa ggagctaatg        60
     cgtcagaaaa aagccttcat aatcccggcc acgatattct tcgtgatctt ctacttcggg       120
     cttccggtgc tgacgggctt caccaccctg ctcgacgcgc aggtgatagg ctcgatcagc       180
     ctggcatacc tgtatgcctt cgcgcagttc gcgatgacct ggatcctgat gcacctgtac       240
     ctcagccggg ccaaccggtg ggacgagctg gttgacaggg cccgccgcca ggccgccgaa       300
     ggggaggtct cctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page