(data stored in ACNUC7421 zone)

EMBL: CP000386.PE147

CP000386.PE147       Location/Qualifiers
FT   CDS_pept        complement(154840..156525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr3825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03128"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ0"
FT                   /protein_id="ABG03128.1"
FT                   /translation="MDAPELVLGPLLRFVGPREATVWVETSRPAEVEVRPAGGPPPSRE
FT                   RTFSVAGHHYALVTLRGLEPGSSCGYEVLLDGRRRWPPSGGPFPPPLIRTPDPSSGRLR
FT                   LAFGSCRVSVPHEPPYTLRRGSLKRGGVLRRGFYERDALYALALRMRGQPPGRWPDALL
FT                   MLGDQIYADEVSPQAKEFIRSRRDTSKPPGEQVADFEEYTRLYLEAWRTPAIRWLLSTV
FT                   PSAMIFDDHDVHDDWNTSEAWVRKMRSKPWWEERIVGAFMSYWVYQHLGNLSPAELEED
FT                   PLFAKVRGSRDATQTLRGFARAADRDVAANRWSFRRDFGRVRLVVADSRAGRVLSEGRR
FT                   AMLDEAEWAWIEEQVLSGGFDHLLFATSLPFVLSPGLHHLEAASEAVCGGAWGRAAARA
FT                   GEAVRQALDLEHWSAFGRSFAALSGLLRRAASGEGAPASIAVLSGDVHHGYLAALDLGP
FT                   GARSPAYQAVGSPIRNPLGLPERLALRAAWTRAGAALGRGIARLAGVGEPPVGWRLLHQ
FT                   SPWFDNHISTLSFEGRRATLLVEKTTPEDGKPPKLLPILERRLA"
     atggacgctc ccgagctcgt cctgggcccc ctgctccgct tcgtgggccc ccgcgaggcc        60
     acggtgtggg tggagacctc ccgccccgcc gaggtcgagg tgcgccccgc agggggcccg       120
     cccccctcga gggagcgcac cttctctgtc gccgggcacc actacgcgct ggtgacgctc       180
     cggggtctcg agccgggctc ctcctgcggc tacgaggtgc tcctcgacgg aagaaggcgc       240
     tggccgccct ccggcggccc cttcccgccc cccctgatcc ggacccccga cccctcctcc       300
     gggcgcctcc ggctggcctt cggctcctgc cgggtctccg tgccgcacga gccgccctac       360
     acgctccggc ggggctcgct gaagcgcggc ggcgtgctgc ggcgcggctt ctacgagcgg       420
     gacgcgctct acgcgctggc cctgaggatg cgcggccagc cgcccggccg ctggcccgac       480
     gcgctgctga tgctgggcga ccagatctac gccgacgagg tctctcccca ggcgaaggag       540
     ttcatccgct cccgcaggga cacctcgaag cccccgggcg agcaggtggc ggacttcgag       600
     gagtacacga ggctctacct ggaggcctgg cggacccccg ccatccgctg gctgctctcc       660
     accgtgccct ccgccatgat cttcgacgac cacgacgtcc acgacgactg gaacacctcg       720
     gaggcgtggg tgcgcaagat gcgctcgaag ccctggtggg aggagcggat cgtcggggcg       780
     ttcatgtcgt actgggtcta ccagcacctg ggcaacctct cccccgccga gctggaggag       840
     gaccccctgt tcgcgaaggt caggggctcg cgggacgcca cgcagacgct gcgcggcttc       900
     gcccgcgccg ccgaccggga cgtcgccgcg aaccgctgga gcttccgccg ggacttcggc       960
     cgggtccgcc tggtggtcgc cgactcccgg gcggggaggg tgctctccga gggcaggcgc      1020
     gccatgctcg acgaggcgga gtgggcgtgg atcgaggagc aggtgctctc cggcggcttc      1080
     gaccacctgc tcttcgccac ctcccttccc ttcgtgctct cccccgggct ccaccacctg      1140
     gaggcggcga gcgaggcggt gtgcggcggg gcctggggcc gggcggccgc ccgggccggc      1200
     gaggccgtcc ggcaggcgct ggacctcgag cactggagcg ccttcgggcg ctccttcgcc      1260
     gccctctccg ggctgctgcg ccgggcggcc tcgggggagg gggccccggc ctcgatcgcg      1320
     gtcctctccg gcgacgtgca ccacggctac ctggcggccc tggacctcgg ccccggcgcg      1380
     aggagccccg cctaccaggc cgtcggctcc cccatccgca accccctcgg gctgcccgag      1440
     cgcctggccc tgcgcgccgc ctggacccgc gccggcgccg ccctgggccg gggcatcgcc      1500
     cgcctcgccg gggtgggcga gccgccggtg ggctggcgcc tcctgcacca aagcccctgg      1560
     ttcgacaacc acatctccac cctgagcttc gagggccgca gggccaccct gctcgtggag      1620
     aagaccaccc cggaggacgg gaagcccccc aagcttctcc ccatcctcga gcgccgcctg      1680
     gcctga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page