(data stored in ACNUC7421 zone)

EMBL: CP000386.PE151

CP000386.PE151       Location/Qualifiers
FT   CDS_pept        complement(159997..160665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03132"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP6"
FT                   /protein_id="ABG03132.1"
FT                   /translation="MGEIRRVYTRCPLCGQIFRAAHAGSYITVGRDTDLCPRFPGRRFD
FT                   AARLIRSEITMCPRCNFASAEDFRELDLSFDERYDLEERLRGDGLLRIFRANQPPWLAF
FT                   HAAEICGQERRLPARELGDLCLRASWVCRKAGERAFESTFQLRAVRYFMRALDNEELEG
FT                   RRLPVTTYLVGELNRRLGHHREALNWYVNAERTMQAVGRMAWLDRLISRQSKLAREQAA
FT                   "
     atgggagaga ttaggcgcgt ctacaccagg tgccctctat gcggccagat cttccgcgcg        60
     gcccacgcgg ggagctacat caccgtgggg cgcgacacgg acctgtgccc gcgcttcccc       120
     gggcgccggt tcgacgcggc gcgcctgatc cgcagcgaga tcaccatgtg cccccggtgc       180
     aacttcgcct ccgcggagga cttcagggag ctggacctct ccttcgacga gcgctacgac       240
     ctggaggagc ggctgcgggg ggacgggctg ctcaggatct tccgggccaa ccagccgccg       300
     tggctggcct tccacgccgc tgagatctgc ggccaggagc ggcgcctccc ggcccgggag       360
     ctcggcgacc tctgcctgcg cgcctcctgg gtgtgccgca aggccgggga gcgcgccttc       420
     gagagcacct tccagctgcg cgccgtccgg tacttcatgc gcgccctgga caacgaggag       480
     ctcgagggcc ggaggctccc ggtgaccacc tacctggtag gcgagctcaa ccgccgcctc       540
     ggccaccacc gcgaggcgct caactggtac gtcaacgccg agcgcaccat gcaggcggtg       600
     gggaggatgg cctggctgga ccgcctgatc tcccgccaga gcaagctcgc ccgcgagcag       660
     gccgcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page