(data stored in ACNUC7421 zone)

EMBL: CP000386.PE152

CP000386.PE152       Location/Qualifiers
FT   CDS_pept        161064..162134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0155"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: sth:STH1236
FT                   sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03133"
FT                   /db_xref="GOA:Q1AZP5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP5"
FT                   /protein_id="ABG03133.1"
FT                   /translation="MQAGRLGILSVLAAALLALAAACGGGGGGGEQQGGGGGGGEAEVR
FT                   PAMVTDVGGLGDQSFNDSAYRGLKRAGEEFGVKVEVLESNAPTDYVNNLSQLAESGYSP
FT                   VFAIGFLMTDAVTEVSQQFPDTQFAIVDSVVEQPNVASLVFREQEGSYLAGVVAGLMTQ
FT                   EETPYTNPDDKVVGFLGGQESDLIRKFQAGYEAGVEAACPDCEVLVQYAGTTPEAFNDP
FT                   ARGKEIALQQINEGADIIYHASGATGAGLFEAAREQKIFAIGVDSDQAKLFPDAPILTS
FT                   VVKRVDNAVFQTIEAARGGEFPGGEVQEFGLEDGGLSLAPFYRFDRFVPQKVKDEVDRA
FT                   REGIISGEIKVPEKPQ"
     atgcaagcag gaagactggg cattctgagc gtgttggcag ccgcgttgct agctctcgcc        60
     gcggcctgcg gcggcggagg cggcgggggc gagcagcagg gcggaggcgg cgggggagga       120
     gaggccgagg tgcgcccggc gatggtcacc gacgtcgggg ggctcggcga ccagagcttc       180
     aacgactccg cctaccgggg cctcaagagg gccggcgagg agttcggggt gaaggtcgag       240
     gtgctggagt ccaacgcccc caccgactac gtgaacaacc tctcgcagct cgccgagtcc       300
     ggttacagcc cggtcttcgc catcggcttt ctgatgaccg acgcggtcac cgaggtctcc       360
     cagcagttcc cggacaccca gttcgccatc gtggactcgg ttgtggagca gccgaacgtg       420
     gcgagcctgg tcttccggga gcaggagggg agctacctgg ccggggtggt cgcggggctc       480
     atgacccagg aggagacccc ctacaccaac cccgacgaca aggtggtcgg ctttctcggc       540
     gggcaggagt ccgacctcat ccgcaagttc caggcggggt acgaggcggg ggtagaggcg       600
     gcctgtccgg actgcgaggt gctggtgcag tacgccggga ccacccccga ggcgttcaac       660
     gatccggcgc ggggcaagga gatcgcgctg cagcagatca acgagggggc ggacatcatc       720
     taccacgcct ccggggccac gggcgcgggg ctcttcgagg cggcgcggga gcagaagatc       780
     ttcgccatcg gcgtggactc cgaccaggcc aagctcttcc ccgacgcccc catcctgacc       840
     tcggtggtca agcgggtgga caacgcggtc ttccagacca tagaggcggc cagaggcggc       900
     gagttccccg gcggcgaggt gcaggagttc ggcctggagg acggcgggct cagcctcgcc       960
     cccttctacc gcttcgaccg cttcgtgccc cagaaggtca aggacgaggt ggaccgggcc      1020
     cgcgagggga taatcagcgg cgagataaag gtccccgaga agccgcagta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page