(data stored in ACNUC7421 zone)

EMBL: CP000386.PE158

CP000386.PE158       Location/Qualifiers
FT   CDS_pept        complement(168235..168627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03139"
FT                   /db_xref="GOA:Q1AZN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN9"
FT                   /protein_id="ABG03139.1"
FT                   /translation="MRKLAVLAALVGLLAWAAPAHAQGASAAGEQYEYGAAGAAGSTMA
FT                   GRDLIIDVTGRLAGEGSGAARGAGSYVSALGGGEAASASAQVPAGAPPAAAGITELPDT
FT                   GGVRVILLPFGAVLLLLAARLIKRSL"
     atgaggaagc ttgcggtgct tgcggcgctg gtggggttgc tggcgtgggc ggctcccgcc        60
     cacgctcagg gggcttccgc cgccggggag cagtacgagt acggggccgc gggcgccgcc       120
     ggctcgacga tggccggccg ggacctcatc atagacgtca cggggaggct ggccggcgag       180
     gggtccggtg cggcgcgggg cgccggctcc tacgtctcgg cgctcggcgg cggggaggcg       240
     gcctccgcga gcgcccaggt tcccgcgggc gcccccccgg ccgccgccgg gataaccgag       300
     ctccccgaca ccgggggcgt ccgggtgatt ctcctgccct tcggggcggt gctgctcctg       360
     ctggccgccc ggctcatcaa gcgctccctc tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page