(data stored in ACNUC7421 zone)

EMBL: CP000386.PE160

CP000386.PE160       Location/Qualifiers
FT   CDS_pept        169065..169478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN7"
FT                   /protein_id="ABG03141.1"
FT                   /translation="MILTHEYIRHRSGYAFGAGCCWIRIYRGGPGDAPVVICEEVPGSG
FT                   ASVSEMSSQLAAEVIRDHFAGGLPDLPRPLLWIERRPARRGRRERYFLLTFPSYTPKPE
FT                   APGFVRRVTLGPPEREPLAAEEVAALTGGAPVP"
     gtgatactca cccacgagta catccggcac cggtcggggt atgcctttgg ggcggggtgt        60
     tgttggatcc ggatctaccg gggcgggccg ggggatgcgc cggtggtgat ctgcgaggag       120
     gtgccgggca gtggggcgag cgtctcggag atgtcctccc agctggccgc cgaggttatc       180
     cgggaccact tcgccggggg gcttccggac ctgccgcgcc cgctgctgtg gatagagcgc       240
     cgtccggccc ggcgggggag gcgggagagg tactttctgc tgaccttccc ctcctacacc       300
     ccgaaaccgg aggcgcccgg tttcgtcagg cgggtgacgt tggggcctcc ggagcgcgag       360
     ccgctggcgg cggaggaggt ggcggcgctg accggcgggg cgcctgtgcc gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page