(data stored in ACNUC7421 zone)

EMBL: CP000386.PE161

CP000386.PE161       Location/Qualifiers
FT   CDS_pept        169553..169960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03142"
FT                   /db_xref="GOA:Q1AZN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN6"
FT                   /protein_id="ABG03142.1"
FT                   /translation="MEPAGSFLRMLLRRPPRPLLGGDEEGPEARVRGPLFPRPVIHALL
FT                   AAFAGFSMLTFDWFGLLLLNSGGVFRQIGALNALRVTAVLMAGIAVPSVLLMVHYRRMY
FT                   TYTSSENVFFAITFSLSFMMGLPCGLVGFFG"
     ttggagccgg ccggaagctt tctcaggatg ctcctgcggc gcccgccccg cccgctcctt        60
     ggcggcgacg aggaggggcc ggaggcccgc gtgcggggcc cgctgttccc gcggccggtg       120
     atccacgcgc tgctcgccgc gttcgcgggc ttctccatgc tcaccttcga ctggttcggg       180
     ctgctgctgc tcaactccgg gggcgtcttc cggcagatcg gggcgctcaa cgccctgcgg       240
     gtcacggcgg tcctgatggc ggggatcgcg gtcccttcgg tgctgctcat ggtccactac       300
     cgccggatgt acacctacac ctcgagcgag aacgtgttct tcgccatcac cttctcgctg       360
     tccttcatga tggggctgcc ctgcgggctc gtggggttct tcgggtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page