(data stored in ACNUC7421 zone)

EMBL: CP000386.PE162

CP000386.PE162       Location/Qualifiers
FT   CDS_pept        complement(169977..170399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0165"
FT                   /product="SUF system FeS assembly protein"
FT                   /note="TIGRFAM: SUF system FeS assembly protein; PFAM:
FT                   nitrogen-fixing NifU-like-like; KEGG: lmf:LMOf2365_2383
FT                   NifU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03143"
FT                   /db_xref="GOA:Q1AZN5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN5"
FT                   /protein_id="ABG03143.1"
FT                   /translation="MMRDLYGQVIMDHYRRPRNRGELEDADLTRHLLNPLCGDEVTVYA
FT                   RFEGDRVAEASFTGRGCSISQASASMMTERLRGKSREEAEAEISRFKRMMTGEEEFPEG
FT                   DDLAALKGVIQYPSRIRCATLAWEAFQQGLEEKGAP"
     atgatgcgcg acctttacgg ccaggtcatc atggaccact accggcgccc ccgcaaccgg        60
     ggcgagctgg aggatgccga cctcacccgg cacctcctca accccctctg cggcgacgag       120
     gtgaccgtct acgccaggtt cgagggggac cgggtggccg aggcgagctt tacgggccgg       180
     ggctgctcca tctcgcaggc ctcggcctcc atgatgaccg agcggctccg gggcaagagc       240
     cgcgaggagg cggaggcgga gatctcccgc ttcaagcgga tgatgaccgg ggaggaggag       300
     ttccccgagg gagacgacct cgccgcgctg aagggcgtga tccaataccc ctcccgcatc       360
     cgctgcgcca ccctggcctg ggaggccttc cagcaggggc tcgaggagaa gggcgccccg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page