(data stored in ACNUC7421 zone)

EMBL: CP000386.PE163

CP000386.PE163       Location/Qualifiers
FT   CDS_pept        complement(170396..171622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0166"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="TIGRFAM: cysteine desulfurases, SufS subfamily;
FT                   PFAM: aminotransferase, class V aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase
FT                   Pyridoxal-dependent decarboxylase; KEGG: gka:GK2993
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03144"
FT                   /db_xref="GOA:Q1AZN4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN4"
FT                   /protein_id="ABG03144.1"
FT                   /translation="MYDVLKVRRDFPILEREVNGRPLVYLDNAATSQKPLQVIRTLSRY
FT                   YERHNANIHRGVHRLAEEATGLYEEARGKVARFIGAPDPRGLVFTRGTTESINLVAHAW
FT                   GRKNLREGDEVVLTEAEHHSNLVPWQLAARDTGARLRFIPVLDDGTLDMEAAEHLIGPR
FT                   TRLVGCVHASNVLGTVNPVERLAELAHEAGALMLVDGAQSAPHLPVDVTSLGCDFFAAS
FT                   GHKMLGPTGVGFLWARPELLEEMEPFLGGGEMIREVRLERSTWNEIPYKFEAGTMNIAQ
FT                   AIGLGAAVDYLGSLGMESVREHERRLGAYAYRRLAGVEGITLYGPAENRTGVVAFNLPE
FT                   VHPHDLSQLLDQEGVAIRSGHHCCQPLMRRLGVVATARASLYLYNTEEEVEALVEAIAR
FT                   AREFFEAPA"
     atgtacgacg tcctcaaggt gcggcgcgac tttcccatcc tcgagcggga ggtgaacggc        60
     cgcccgctcg tctacctgga caacgcggcg acctcccaga agccgctgca ggtcatccgg       120
     accctctccc ggtactacga gcggcacaac gccaacatcc accgcggcgt ccaccgcctg       180
     gccgaggagg ccaccgggct ctacgaggag gcgcgcggca aggtggcccg ctttatcggg       240
     gctcccgacc cccgcggcct cgtcttcacg cgggggacca ccgagtccat aaacctcgtc       300
     gcccacgcct ggggcagaaa gaacctgcgc gagggcgacg aggtggtgct caccgaggcc       360
     gagcaccact ccaacctggt gccctggcag ctcgccgcgc gggacaccgg cgcgaggctt       420
     cgcttcatcc cggtcctgga cgacggcacg ctggacatgg aggcggcgga gcacctgatc       480
     gggccgcgga cgcggctcgt gggctgcgtg cacgcctcca acgtgctcgg cacggtcaac       540
     ccggtggagc ggctggcgga gctggcgcac gaggcggggg ccctgatgct ggtcgacggg       600
     gcgcagagcg cgccgcacct gccggtggac gtaacctctc tgggctgcga cttcttcgcg       660
     gcgagcgggc acaagatgct cgggccgacc ggggtgggat tcctgtgggc ccgccccgag       720
     cttctcgagg agatggagcc gttcctcggc gggggcgaga tgatccggga ggtccgcctg       780
     gagcgttcca cctggaacga gatcccctac aagttcgagg ccgggacgat gaacatcgcc       840
     caggcgatcg ggctgggggc cgccgtggac tacctgggct ccctggggat ggagagcgtc       900
     cgggagcacg agcggcgcct cggggcgtac gcctaccgcc ggctcgccgg ggtcgagggg       960
     atcaccctct acggcccggc ggagaaccgg acgggggtcg tggccttcaa cctccccgag      1020
     gtgcacccgc acgacctctc ccagctcctg gaccaggagg gcgtcgccat aaggagcggc      1080
     caccactgct gccagccgct gatgcgccgc ctcggggtgg tggcgaccgc ccgggccagc      1140
     ctctacctgt acaacacgga ggaggaggtg gaggcgctgg tcgaggccat cgcccgcgcc      1200
     cgcgagttct tcgaggcgcc ggcatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page