(data stored in ACNUC7421 zone)

EMBL: CP000386.PE165

CP000386.PE165       Location/Qualifiers
FT   CDS_pept        complement(172002..173363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0168"
FT                   /product="Iron-regulated ABC transporter permease protein
FT                   SufD"
FT                   /note="TIGRFAM: FeS assembly protein SufD; PFAM: SufBD;
FT                   KEGG: dra:DR2101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03146"
FT                   /db_xref="GOA:Q1AZN2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN2"
FT                   /protein_id="ABG03146.1"
FT                   /translation="MSTNGVPEVLRRKGIGIEAVKALAAFKDEPGWLREKRLAAWRTFE
FT                   EIPMPTMRDEAWRYTDVSDVRFEEYVPYAPSPDVEREGDLPDAVQRLIKEGEENSALLV
FT                   QHNSETTYARTDEALRARGVIFTDLHTALREHGELVRERLFRLVPEGYDKFAALSAAAF
FT                   SGGSFLYVPRGVEVEVPIQSYRWLDVAGSIMPRTLVIVEEGASVTYIDEYASEDGEEPA
FT                   LSNGAVELFVGQGAHLQYVSLQNWARNVVHFNTIRSQAEKDATINSLVVSFGAQLSRTN
FT                   VEAGLTAPGSDSEMLGLYFADEDQLIDHHTLQDHIAPQAHSDLLYKGALRDESLTVFSG
FT                   LIRVEPGAQKTDAYQTNRNLILGTDEAMAVSLPNLEIMADDVKCSHGATTGQVDDLELF
FT                   YLMSRGIPRIEAEKLVVFGFFGEVTSRIPLRGLKEKLDRAIEEKIGLGFEERVA"
     atgagcacga acggcgtgcc ggaggtactg aggcgcaagg ggatagggat tgaggcggtc        60
     aaggcgctcg ccgccttcaa ggacgagccg ggctggctgc gggagaagcg ccttgcggcc       120
     tggcggacct tcgaggagat cccgatgccc accatgcgcg acgaggcgtg gcgctacacc       180
     gacgtctcgg acgtgcgctt cgaggagtac gtgccctacg ccccgagccc cgacgtggag       240
     cgcgaggggg acctcccgga cgccgtgcag cggctcataa aggagggcga ggagaactcg       300
     gcgctcctgg tgcagcacaa ctccgagacc acctacgccc gcacggacga ggcgctgcgc       360
     gcccggggcg tcatcttcac cgacctgcac accgccctca gggagcacgg ggagctggtg       420
     cgggagaggc tcttcaggct cgtccccgag ggctacgaca agttcgccgc gctctcggcg       480
     gcggccttct ccggcgggtc gttcctgtac gtgccgcgcg gggtcgaggt ggaggtcccg       540
     atccagagct accggtggct cgacgtggcc ggctcgatca tgccgcgcac cctcgtgatc       600
     gtcgaggagg gggcctcggt gacctacatc gacgagtacg cctccgagga cggcgaggag       660
     ccggccctct ccaacggcgc ggtcgagctc ttcgtgggcc agggggccca cctgcagtac       720
     gtctcgctgc agaactgggc gcgcaacgtc gtccacttca acaccatccg cagccaggcg       780
     gagaaggacg ccaccatcaa cagcctggtg gtctccttcg gggcccagct ctccaggacc       840
     aacgtggagg cggggctcac cgcccccggc agcgactcgg agatgctcgg cctctacttc       900
     gccgacgagg accagctcat agaccaccac accctgcagg accacatcgc cccccaggcc       960
     cactccgacc tcctgtacaa gggggccctg cgggacgagt cgctcaccgt cttctccggc      1020
     ctcatccggg tagagcccgg ggcgcagaag accgacgcct accagaccaa ccgcaacctc      1080
     atcctgggca ccgacgaggc gatggccgtc tccctgccga acctggagat catggccgac      1140
     gacgtgaagt gctcccacgg ggcgaccacc gggcaggtgg acgacctgga gctcttctac      1200
     ctgatgagcc gcggcatccc gcgcatcgag gcggagaagc tcgtggtctt cgggttcttc      1260
     ggggaggtga cgagccgtat ccccctcagg ggcctcaagg agaagctgga ccgggcgatc      1320
     gaggagaaga tcggcctggg cttcgaggag cgggtggctt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page