(data stored in ACNUC7421 zone)

EMBL: CP000386.PE166

CP000386.PE166       Location/Qualifiers
FT   CDS_pept        complement(173360..173815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0169"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: tbd:Tbd_2614 universal stress
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03147"
FT                   /db_xref="GOA:Q1AZN1"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN1"
FT                   /protein_id="ABG03147.1"
FT                   /translation="MFPTKILLATDGSEHARRAARAAVELAQKTGSELHVVHVGPAVTS
FT                   IFAYTELDPARVEEEARKALDEEVRSIEESGGAVAEGHVLLGNPAESIVSLAEEMGAGL
FT                   IVVGSRGLGGLRRALMGSVSESVVRHAHCPVLVVRGDAEDAEGEGDR"
     atgttcccga cgaagatcct tctggcgacc gacggttcgg agcacgcccg gcgggcggcc        60
     cgggcggcgg tggagcttgc ccagaagacc ggctccgagc tacacgtggt gcacgtgggg       120
     ccggccgtca cgagcatctt cgcctacacc gagctcgacc cggcgcgggt cgaggaggag       180
     gcgcgcaagg cgctggacga ggaggtgcgg agcatcgagg agtccggcgg cgcggtcgcc       240
     gaggggcacg tgctgctggg caaccccgcg gagagcatcg tctcgctggc cgaggagatg       300
     ggggcggggc tcatcgtggt cggcagccgg ggcctcggcg gcctgcggcg ggccctgatg       360
     ggcagcgtct cggagagcgt tgtccggcac gcgcactgcc cggtgctggt ggtgcgcggg       420
     gacgcagaag acgcggaagg agaaggtgat agatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page