(data stored in ACNUC7421 zone)

EMBL: CP000386.PE173

CP000386.PE173       Location/Qualifiers
FT   CDS_pept        complement(179239..180393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0176"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   gsu:GSU0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03154"
FT                   /db_xref="GOA:Q1AZM4"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM4"
FT                   /protein_id="ABG03154.1"
FT                   /translation="MGGAAGDMILASLISAGAPAGEVEESVRGLGLPVRLELRRVEISG
FT                   IAALGLRVDAPEEHAHRTFRDIRRLIEGSGLPERAAGRALAAFGLLAAAEGRVHGVPPE
FT                   EVAFHEVGAADSIADIVGACAALELLGAETVSCGPLPMGSGVVEAAHGPLPVPGPATLE
FT                   VLRGCRVRWPEEEREMTTPTGAALLRALTGGEFSDAAPPMVLGAAGYGAGTARLRGAPN
FT                   LLRAVVGRLEGPVGGLEVLEANIDDAPGEVLGAAVERLLEAGAPDAWLEPVVMKRGRGA
FT                   YKLCALARRQDRERLARLMMRETGSLGVRHHGVGRTVAERRLVEVELPYGRCRVKVGSL
FT                   DGEDFAVAPEHADAARLARESGRPLPRVYDDARRAASELLRQSP"
     gtggggggcg cggctgggga catgatcctg gccagcctca tctccgccgg ggccccggcg        60
     ggcgaggtcg aggagagcgt gcgcggcctc gggctgcccg ttcgtctgga gctccggcgg       120
     gtcgagatca gcggcatagc cgccctcggc ctgagggtcg acgcgcccga ggagcacgcc       180
     caccgcacct tccgcgacat ccgccgcctc atcgagggct ccggcctccc cgagcgggcc       240
     gccgggaggg cgctcgcggc cttcggcctt ctggccgccg ccgagggcag ggtgcacggc       300
     gtcccgccgg aggaggtcgc cttccacgag gtcggcgccg ccgactccat agcggacatc       360
     gtgggcgcct gcgcggcgct ggagctgctc ggcgcggaga ccgtaagctg cgggccgctc       420
     cccatgggca gcggcgtcgt cgaggccgcc cacggcccgc tgccagtgcc gggcccggcc       480
     accctggagg tgctgcgggg ctgcagggtg cggtggcccg aggaggagcg ggagatgacc       540
     acccccacgg gggcggccct cctgagggcc ctcaccggcg gggagttctc ggacgccgcc       600
     ccgccgatgg tgctgggggc cgccggctac ggggcgggga cggcccgcct gcggggcgcg       660
     ccgaacctgc tgcgggcggt ggtgggccgc ctggagggcc cggtcggggg gctggaggtg       720
     ctggaggcca acatagacga cgcgccgggc gaggtgctcg gcgcggccgt ggagcggctc       780
     ctcgaggcgg gcgcccccga cgcctggctc gagccggtcg tcatgaagcg cggccgcggg       840
     gcctacaagc tgtgcgccct ggcccggcgg caggacaggg agcgcctcgc ccggctgatg       900
     atgcgcgaga ccgggagcct cggcgtccgc caccacgggg tagggcgcac cgtggcggag       960
     cggcgcctcg tggaggtcga gctgccctac ggccggtgcc gggtgaaggt gggaagcctc      1020
     gacggagaag acttcgccgt ggcccccgag cacgccgacg cagcccgcct cgcccgggag      1080
     agcgggaggc cgctcccgcg ggtctacgac gacgcccgcc gggctgcgtc ggagctgctg      1140
     cggcagagcc cctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page