(data stored in ACNUC7421 zone)

EMBL: CP000386.PE174

CP000386.PE174       Location/Qualifiers
FT   CDS_pept        complement(180420..180770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03155"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM3"
FT                   /protein_id="ABG03155.1"
FT                   /translation="MSEIPERIEREMFEIRSRMAPDVRDLRRHVEPRVVVQQTKEKAKA
FT                   RLKEALGRLGRSVAESARRQARLAREAGRKRNPSVFTDAVKSDPRPMILLAVALAAAAM
FT                   VVRRISGGGSGK"
     gtgagcgaga taccggagcg catagagcgg gagatgttcg agatccggag ccggatggcg        60
     ccggacgtca gggatctgcg ccggcacgtg gagcccaggg tcgtcgtcca gcagaccaag       120
     gagaaggcga aggcgcggct gaaggaggcc ctgggccgcc tggggcgcag cgtcgccgaa       180
     tcggcccgcc ggcaggcccg gctcgcccgg gaggccgggc gcaagcgcaa cccgtccgtc       240
     ttcaccgacg cggtgaagag cgacccccgc ccgatgatct tgctggccgt cgcgctcgcg       300
     gccgccgcca tggtcgtccg caggatctcc gggggaggct cggggaagta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page