(data stored in ACNUC7421 zone)

EMBL: CP000386.PE182

CP000386.PE182       Location/Qualifiers
FT   CDS_pept        complement(186078..187913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0185"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region ABC
FT                   transporter related; SMART: ATPase; KEGG: sma:SAV3872
FT                   putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03163"
FT                   /db_xref="GOA:Q1AZL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL5"
FT                   /protein_id="ABG03163.1"
FT                   /translation="MGKTWRKRLRLGLGWLAGDMREGGGPVAAAPAMPLREILRRFWPH
FT                   ARPYRRWLVPLLLLAALGPAVETATIWMYKVLVDGVLIPGEFGLLPWVVLAYLGLTLLD
FT                   GAISFLDGYLSEWVGGRFILRLRTGLFRHLQTLSLDFFDRRKLGDTVARISDDVEEIEE
FT                   LLLSGAVSAVTYAFQLLFFVGALFYLEWRLALVSLLVAPLFWLVARRFSRRIKRAAREE
FT                   RRKAGSIGAVAEESLSNAALVQAYNRQEHEVARFHRENEEGFAAQMVAARLSALFSPLV
FT                   NLIELLGALTVVSFGAYLLSRGALTVGGLLAFLVYLGMLYRPIRGFSRLANSFFSAAAA
FT                   AERVAELLQMRPAVRGGALEPGRLRGEVRFREVTFRYPGAAEPALRGVSFEARPGEVVA
FT                   LAGPSGAGKSTVVRLLLRFYDPEGGSISIDGYELRELSLRALRENVAVVLQEAMIFDGT
FT                   VRENIAYGRPGATEREIREAARAADAHEFIERLPQGYDTVVGQKGRLLSGGQRQRIAIA
FT                   RAMLRDAPVLVLDEPAAGLDAGSQERIMKPLRRLMAGRTTIVISHDLLAVREATRIVVL
FT                   EGGRVAGSGTHAELLERGGLYAGLFRRQSPERGAV"
     atgggcaaga cctggagaaa acggctgcgc ctggggctcg ggtggctcgc gggcgacatg        60
     cgggagggcg ggggcccggt cgcggcggcc cccgcgatgc cgctgcggga gatcctgcgg       120
     cgcttctggc cccacgccag gccctaccgg cgctggctcg ttcccctgct cctgctcgcg       180
     gcgctcggcc ccgccgtgga gaccgccacc atctggatgt acaaggtgct cgtcgacggg       240
     gtgctcatcc ccggcgagtt cggcctgctg ccctgggtcg tgctcgccta cctgggcctc       300
     accctgctgg acggcgcgat ctcctttctc gacggctacc tctccgagtg ggtcggcggg       360
     cgctttatcc tgcggctcag gaccgggctc ttccggcacc tgcagaccct ctcgctggac       420
     ttcttcgacc gccgcaagct cggcgatacg gtcgccagga tctccgacga cgtggaggag       480
     atagaggagc tcctgctctc gggggccgtc tccgccgtca cctacgcctt ccagctcctc       540
     ttcttcgtgg gggccctctt ctacctggag tggcgactgg cgctcgtctc gctgctcgtc       600
     gcgccgctgt tctggctcgt cgcccggcgc ttctcccgca ggataaagcg cgcggcccgc       660
     gaggagcggc ggaaggccgg ctccatcggc gccgtcgccg aggagagcct ctccaacgcc       720
     gccctggtgc aggcctacaa ccggcaggag cacgaggtcg cccgcttcca ccgcgagaac       780
     gaggagggct tcgccgccca gatggtcgcg gcgcggctct ccgccctctt ctcgccgctg       840
     gtgaacctga tagagctgct cggggcgctg acggtggtct ccttcggggc ctacctgctc       900
     tcgcggggcg ccctcacggt cggcggcctg ctggccttcc tggtctatct ggggatgctc       960
     taccgcccca tacgcggctt cagccggctc gccaactcct tcttctccgc ggcggccgcc      1020
     gcggagcggg tggcggagct gctgcagatg aggcccgcgg tgcgcggcgg cgcgctcgag      1080
     ccgggccgcc tgcgcggcga ggtgcgcttc agagaggtca ccttccgcta cccgggcgcc      1140
     gcggagccgg cgctccgcgg ggtctccttc gaggcgcgcc ccggggaggt cgtggcgctc      1200
     gccggcccga gcggtgcggg caagtccacc gtggtccggc tgctcctgcg cttctacgac      1260
     cccgagggcg ggagcatctc catcgacggg tacgagctgc gcgagctctc gctgcgcgcg      1320
     ctgcgcgaga acgtcgcggt cgtgctgcag gaggccatga tcttcgacgg caccgtccgg      1380
     gagaacatag cctacgggag gcccggcgcc acggagcggg agatccggga ggccgcccgc      1440
     gccgccgacg cccacgagtt catagaacgg ctgccgcagg ggtacgatac cgtcgtcggc      1500
     cagaagggca ggctcctctc cggcgggcag cggcagcgga tcgccatagc ccgcgcgatg      1560
     ctccgggacg ccccggtgct cgtgctggac gagcccgccg ccgggctcga cgcgggctcg      1620
     caggagagga tcatgaaacc cctgagacgg ctcatggcgg ggaggacgac catagtgatc      1680
     tcgcacgacc tgctcgcggt gcgcgaggcg acccgcatcg tcgtgctgga gggcgggcgg      1740
     gtggccggga gcggcaccca cgcggagctt ctggagcgcg gcggcctcta cgccgggctc      1800
     ttccgccggc agagcccgga gaggggggcg gtgtga                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page