(data stored in ACNUC7421 zone)

EMBL: CP000386.PE184

CP000386.PE184       Location/Qualifiers
FT   CDS_pept        189705..190388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0187"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: gme:Gmet_3383 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03165"
FT                   /db_xref="GOA:Q1AZL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL3"
FT                   /protein_id="ABG03165.1"
FT                   /translation="MRVLIVEDEPGIVRMLERGLSAQGYSCLSAEDGETGLRMALEEDV
FT                   DVVLLDIMLPGLDGREVLRRLRLRRPGLPVLMLTARDEVETKVGSLDAGADDYLTKPFA
FT                   FEELLARIRALVRRADQPESTALRAGDLKLDLLSRRVWRAGRQVELSSREFALLEYLMR
FT                   HPRQVLSRQQILSAVWDYAFDPGSNVVDVYVRYLRRKLDRPGEPSLITTVRGAGYRFDP
FT                   PREEA"
     atgagggtcc tgatcgtaga ggacgagccg ggcatcgtcc ggatgctgga gcgcgggctc        60
     tccgcccagg gctacagctg cctgagcgcc gaggacggcg agacgggtct gcggatggcc       120
     ctggaggagg acgtggacgt ggtgctgctg gacatcatgc tgcccggcct cgacggccgg       180
     gaggtgctcc ggcggctgcg gctgcggcgc ccggggctgc cggtgctgat gctgaccgcc       240
     cgcgacgagg tggagacgaa ggtcggctcc ctggacgccg gcgccgacga ctacctcacc       300
     aagcccttcg ccttcgagga gctcctcgcc cgcatccggg cgctcgtgcg gcgggccgac       360
     cagccggaga gcaccgccct gcgggccggg gacctcaagc tggacctgct ctcgcgccgc       420
     gtctggcgcg ccgggcggca ggtagagctc tcgagccgcg agttcgcgct gctggagtac       480
     ctgatgcgcc atccccggca ggtgctcagc cgccagcaga tcctctcggc ggtctgggac       540
     tacgccttcg acccgggctc taacgtggtg gacgtctacg tccgctacct gcgccgcaag       600
     ctggaccgcc ccggcgagcc ctccctgatc acgacggtcc ggggcgccgg gtaccgcttc       660
     gaccctcccc gggaggaggc gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page