(data stored in ACNUC7421 zone)

EMBL: CP000386.PE185

CP000386.PE185       Location/Qualifiers
FT   CDS_pept        190385..191527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0188"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcl:ABC0532 glycine/D-amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03166"
FT                   /db_xref="GOA:Q1AZL2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL2"
FT                   /protein_id="ABG03166.1"
FT                   /translation="MSRVVVVGAGVVGASAAYHLARAGAEAVLVDGDLPGQATAAGAGI
FT                   VCPALRFGAPEAWRALAFPAVGRYPALVEALASDGEEDVGYAAVGALLVAADGREEAAL
FT                   GEALRSLEELRRAGVAGVGEVRSLSFGEPRELFPFLRDDVPGIYLSGAARVDGRRLRDA
FT                   LERAARRRGARSVRGAASLLLRGGRVRGVRVGGEEIPADAVVAAAGAWTGELCRPAGLR
FT                   VPVYPQRGQIAHLRVPGAQTSRLPIVEGFRTHYMLAFPGGRVVAGATREDGAGFDRRVT
FT                   AGGVHEVLSEALRLAPGLADATLAEVRVGFRPASPDGLPSLGEAVPGLVVATGLGPSGL
FT                   TIGPYAGGLAAELALGGRPALDLEPYAPDRRTTPVPGGGW"
     gtgagccgcg tcgtggtggt gggtgccggg gtggtggggg cgagcgccgc ctaccacctc        60
     gcccgcgccg gggccgaggc ggtgctggtg gacggggacc tgcccggcca ggccacggcc       120
     gccggggccg ggatcgtgtg cccggcgctg aggttcggcg cccccgaggc ctggcgtgcg       180
     ctggccttcc cggcggtcgg ccgctacccg gcgctggtgg aggccctggc ctccgacggc       240
     gaggaggacg tgggatacgc ggcggtcggc gccctgctgg tcgcggcgga cgggcgggag       300
     gaggccgcgc tgggggaggc cctgcggagt ctggaggagc tgcggcgggc cggggtggcg       360
     ggcgtggggg aggtgcgctc cctgtctttt ggggagcccc gcgagctctt cccctttctg       420
     cgggacgacg tgcccgggat atacctctcc ggggccgccc gggtggacgg ccggcggctg       480
     cgggacgcgc tggagcgggc cgcccgccga cgcggcgcgc ggagcgtgcg gggcgcggcc       540
     tccctgctgc tgcgcggggg gagggtccgc ggggtgcggg tggggggcga ggagatcccg       600
     gccgacgccg tggtggcggc ggccggggcg tggaccgggg agctttgccg cccggccggg       660
     ctgcgcgtcc cggtctaccc gcagcgcggc cagatcgcgc acctgcgcgt gccgggcgcg       720
     cagacctccc gcctgcccat agtcgagggc ttccgcaccc actacatgct cgccttcccg       780
     ggggggcgcg tggtggccgg ggccacgcgg gaggacgggg cgggctttga ccggcgggtg       840
     acggccgggg gcgtccacga ggtgctctcg gaggcgctgc ggctggcccc cggcctcgcg       900
     gacgccacgc tggccgaggt gcgcgtcggc ttccgcccgg cgagccccga cggcctgccc       960
     tccctggggg aggccgtccc ggggctcgtg gtcgccaccg gcctcggccc ctcgggcctg      1020
     accatcggcc cgtacgccgg cgggctcgcc gcggagctcg cgctgggggg gcggcccgcc      1080
     ctggatctgg agccctacgc cccggaccgc aggaccaccc ccgtccccgg cgggggctgg      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page