(data stored in ACNUC7421 zone)

EMBL: CP000386.PE199

CP000386.PE199       Location/Qualifiers
FT   CDS_pept        complement(202808..203749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH1911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03180"
FT                   /db_xref="InterPro:IPR016797"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ8"
FT                   /protein_id="ABG03180.1"
FT                   /translation="MCSGAGSSGASPSARARELVRGAYDHHVHLGPDVMQRRIDDLGLA
FT                   RRFRELGLSGFTLKSHYVPTAERASVVRAAEGVEVFGAIALNAAVGGMNALAVEIAARE
FT                   GARFVWMPTVSAANEAEILSRSDGGGRKLPFWARLQRELEEQGISTEPVRVVDGTGAVL
FT                   PETREVLRVVAAHDLVLATGHLSRDEIFAVVEAAREEGVRRIVITHPEFPSQDLSADDQ
FT                   ASLVEQGALLERCFAPAYGGKVSWEKMFENIRATGPENSFLSTDLGQPANPPVEDGIAL
FT                   MAERLLEAGFSEEEVRVMAVENTRRLAQGVLV"
     atgtgtagcg gggcgggaag ttctggagcc tcaccctccg cgcgggcgcg agagcttgta        60
     cggggtgcct acgaccacca cgtccacctc ggccccgacg tgatgcaaag gaggatcgac       120
     gacctgggcc tggcgcggcg cttcagggag ctggggctct ccggcttcac gctcaagtcg       180
     cactacgtgc cgaccgccga gcgggccagc gtggtccggg cggcggaggg ggtggaggtc       240
     ttcggggcca tcgcgctgaa cgcggccgtc ggcgggatga acgccctggc ggtggagata       300
     gcggcgcggg agggggcgcg cttcgtgtgg atgcccaccg tgagcgccgc caacgaggcg       360
     gagatcctct cccgctccga cgggggcggg aggaagctgc cgttctgggc gcggctgcag       420
     cgcgagctcg aggagcaggg gataagcacc gagcccgtgc gcgtggtgga cgggacgggg       480
     gcggtgctcc ccgagacccg ggaggtgctg cgggtcgtcg ccgcgcacga tttggtgctg       540
     gcgaccgggc acctctcgcg ggacgagatc ttcgcggtcg tcgaggcggc cagggaggag       600
     ggggtgcgca ggatcgtcat aacccacccc gagttcccct cgcaggacct ctccgccgac       660
     gaccaggcga gcctcgtcga gcagggggcc ctcctcgagc gctgcttcgc cccggcgtac       720
     ggcggcaagg tctcctggga gaagatgttc gagaacatcc gggcgacggg gcccgagaac       780
     tccttcctct ccaccgacct cggccagccc gccaacccgc cggtggagga cggcatcgcg       840
     ctcatggcag agaggctgct ggaggcgggg ttcagcgagg aggaggtcag ggtcatggcc       900
     gtcgagaaca cccggcggct cgcgcagggg gtgctcgtct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page