(data stored in ACNUC7421 zone)

EMBL: CP000386.PE2

CP000386.PE2         Location/Qualifiers
FT   CDS_pept        1853..2980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: chy:CHY_2709 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02983"
FT                   /db_xref="GOA:Q1B045"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B045"
FT                   /protein_id="ABG02983.1"
FT                   /translation="MRAVCNTGVLAGKLALVSRGVSTRSPVQVLSGVLLEAREGRLELS
FT                   ATDMELSIRTRSPAEVEEAGRLVIPARIFSDIVRSLPEGMISIEHDVESGAAVLRSREN
FT                   EYRIRAYAAEDFPALPEFSEEGSFRVSGEALVETVQKVSSSYSRDETRPVLTGILISFE
FT                   DSRLRMVTTDSYRLSIKETELATTFEGKREAIIPARAMQEVGRIFSGSDEEQIEVQLSE
FT                   NQALFRVGDVLLGTKLIAGNFPEYRRLLPAAFEREISVNRDEIVGSLRRVNLFAQRQTP
FT                   PVPVSLVFSEGSVEVVVRSGEVGEAHERIPASSEDDFTISFNPGYLLDGISAVDTEKVV
FT                   FKFNEPLKPGLIVPNGEEEPDFRYLIMPMRDPSRA"
     gtgagggccg tttgcaacac aggagttctg gccgggaagc tcgccctggt gtcccggggg        60
     gtttccacga ggtccccggt acaggtgctg agcggggtgc tgttagaggc gcgtgagggg       120
     aggctcgagc tctctgcgac ggacatggag ctctctatcc ggacccgctc tccggccgag       180
     gtggaggagg cgggcaggct ggtcattccg gcgcgcatct tcagcgacat cgtgcgttcg       240
     ctgccggagg ggatgatctc catagagcac gacgtggagt ccggagccgc cgtgctccgc       300
     tcccgggaga acgagtaccg catccgggct tacgccgcgg aggacttccc cgcgctgccg       360
     gagttctcgg aggagggctc cttcagggtt tcgggcgagg cgctggtgga gaccgtgcag       420
     aaggtctcca gctcctactc ccgggacgag acccgtcccg tcctgaccgg catcctcata       480
     agcttcgagg actcccggct caggatggtc accaccgact cctaccggct cagcataaaa       540
     gagaccgagc ttgcgaccac cttcgagggg aagcgggagg ccataatccc ggcccgggcg       600
     atgcaggagg tcggcaggat cttctccggc tccgacgagg agcagataga ggtgcagctc       660
     tccgagaacc aggccctctt ccgcgtcggg gacgtgctgc tcggcaccaa gctcatagcc       720
     ggcaacttcc ccgagtaccg ccggctcttg ccggcggcct tcgagcgcga gatctccgtg       780
     aaccgcgacg agatcgtggg gagcctccgg cgcgtcaacc tcttcgccca gcggcagacc       840
     ccgcccgttc ccgtgagcct cgtcttctcc gaggggtcgg tggaggtggt ggtgcgcagc       900
     ggcgaggtgg gggaggccca cgagcgcatc ccggccagca gcgaggacga cttcaccatc       960
     tccttcaacc ccggctacct cctggacggc atctccgcgg tcgacaccga gaaggtcgtc      1020
     ttcaagttca acgagcctct caagcccggc ctgatcgtgc ccaacgggga ggaggagcct      1080
     gacttccgct acctgattat gccgatgagg gatccctccc gcgcctga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page