(data stored in ACNUC7421 zone)

EMBL: CP000386.PE20

CP000386.PE20        Location/Qualifiers
FT   CDS_pept        21291..21647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B027"
FT                   /protein_id="ABG03001.1"
FT                   /translation="MSEKILAWQTFPPPAPFIRAAEGCKLAAMAEKKTEVKIRAHSPGR
FT                   YPILILELPSGELRAAYHEAGYDLERTKPVGESWLYENAIGRHSFVEVKPPRELPAGEL
FT                   VDYVRRELLAPGGE"
     atgtcggaaa agattttagc atggcaaact ttccctcccc cggcgccctt catccgcgcg        60
     gcggagggtt gtaaactcgc cgccatggcg gagaagaaga cagaggtgaa gatccgggct       120
     cactcccccg gcaggtaccc aatcctgatc ctggagcttc cctcgggcga gctgcgcgcg       180
     gcctaccacg aggccggcta cgacctcgag cgcacgaagc ccgtcgggga gagctggctc       240
     tacgagaacg ccataggccg ccacagcttc gtggaggtga agcctcccag agagctgccg       300
     gccggcgagc tcgtggacta cgtcaggcgc gagctgctcg ctcccggcgg cgagtag          357
//

If you have problems or comments...

PBIL Back to PBIL home page