(data stored in ACNUC7421 zone)

EMBL: CP000386.PE202

CP000386.PE202       Location/Qualifiers
FT   CDS_pept        205837..206664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0205"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase Catechol
FT                   dioxygenase-like; KEGG: atc:AGR_C_4592 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03183"
FT                   /db_xref="GOA:Q1AZJ5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ5"
FT                   /protein_id="ABG03183.1"
FT                   /translation="MVDSARVVRNERLARILPEALGALHEIIERHRITEREWLAVLDFL
FT                   TEVGRKDEFVLLSDVTRTSVLVDSITHEDGAATPSDVEGPLYRENPPWREKPVKIYEEY
FT                   EGIEEGDVLFVRGRVTSTDGTPLGGAILDVWQTGPTGGYDVWDERQPDYNFRGRFGVEE
FT                   DGSYEFQTMVPKPYTVPTDGPVGRLLEAIGQHPWRPAHIHFKVEAEGHETLTTQIFFPD
FT                   DPYLENDTIGAVKPELVRPLERHEDEEEISRRGLDGPFYTCDFDIKLKPAARG"
     atggtcgatt cggcgagagt ggtgcgcaac gagcgcctgg cgcggatact gccggaggcc        60
     ctcggggcgc tgcacgagat catcgagagg caccgcataa ccgagaggga gtggctcgcg       120
     gtcttggact ttctcaccga ggtcggcagg aaggacgagt tcgtcctgct ctccgacgtg       180
     accaggacct cggtgctggt ggactccata acccacgagg acggcgcggc caccccgagc       240
     gacgtggagg gcccgctcta ccgcgagaac ccgccgtggc gggagaagcc ggtcaagatc       300
     tacgaggagt acgagggcat cgaggagggg gacgtgctct tcgtgcgcgg cagggtcacc       360
     tccaccgacg gcacgccatt gggcggtgcg atcctcgacg tctggcagac cggtcccacc       420
     ggcggctacg acgtctggga cgagaggcag ccggactaca acttccgcgg gcgcttcggc       480
     gtcgaggagg acgggagcta cgagttccag accatggtgc ccaagcccta caccgtgccg       540
     accgacgggc cggtggggcg gctgctcgag gccataggcc agcacccctg gcgcccggcg       600
     cacatacact tcaaggtcga ggccgagggg cacgagacgc tcaccaccca gatcttcttc       660
     ccggacgacc cctacctgga gaacgacacc ataggggcgg tcaagcccga gctcgtccgg       720
     cccctggagc ggcacgagga cgaggaggag atctcgcgcc gcggcctcga cggccccttc       780
     tacacctgcg acttcgacat aaagctcaag cccgcggcgc ggggctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page