(data stored in ACNUC7421 zone)

EMBL: CP000386.PE204

CP000386.PE204       Location/Qualifiers
FT   CDS_pept        208090..209073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0207"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: bja:blr2898 putative zinc
FT                   binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03185"
FT                   /db_xref="GOA:Q1AZJ3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ3"
FT                   /protein_id="ABG03185.1"
FT                   /translation="MRAVLLERFGEPSELGPAEVPRPKAREGEVLVEVRAAAVNRSDVL
FT                   NARGSFPATTLPRIPGRDFAGVVVEGPEELLGREVWGTGGGELGFTRDGTHAEYVALPA
FT                   GAAVPVPEGLSLEGAAASGLAYLAAAMGILELGELSAGEAVLVTGAAGGVGGAAAGISR
FT                   WKRASLVIGVVKDESERRAAERAGAGVVVDTSREEVPEAVMAATEGRGVDLVLDAVGGP
FT                   LFEPCLSSLAPQGRMVVLTTVGQRRVSFDLFDFYRKELRLLGLMTSRPGAAESGAVLRS
FT                   LLPGFEAGYLHAPAVAGRYPLEEAAEAYARVESGEAAGRVLLVMAP"
     gtgcgcgcgg tccttttgga gcgcttcggg gagccctcgg agctgggccc ggcggaggtg        60
     ccccggccca aggcccggga gggcgaggtg ctcgtcgagg tgcgcgccgc cgccgtgaac       120
     cgcagcgacg tgctgaacgc gcgcggctcc ttccccgcaa ccaccctgcc ccgcatcccg       180
     ggccgggact tcgccggggt cgtcgtggag gggccggagg agctcctcgg cagggaggtg       240
     tgggggaccg gcgggggaga gctgggcttc acccgggacg gcacccacgc ggagtacgtg       300
     gccctccccg cgggggccgc ggtgcccgtg ccggaggggc tctccctcga aggggccgca       360
     gcctccgggc tcgcctacct cgccgccgcc atggggatcc tcgagctcgg cgagctctcc       420
     gccggggagg cggtgctcgt caccggcgcg gcgggcggcg tcggaggcgc ggcggccggg       480
     atctcgcgct ggaagagggc ctcgctcgtg atcggggtcg tgaaggacga atcggagcgg       540
     cgggcggcgg agagggcggg agccggggtg gtcgtcgaca cctcccgcga agaggtgccc       600
     gaagccgtca tggccgcaac ggaggggagg ggcgtggacc tcgtcctcga cgccgtcggg       660
     ggtcccctct tcgagccgtg cctctcgagc ctcgccccgc agggccgcat ggtcgtcctc       720
     accacggtcg gacagcggcg cgtctccttc gacctcttcg acttctaccg caaggagctg       780
     cgcctgctcg gccttatgac ctcccggccg ggcgccgcgg agagcggcgc cgtcctccgc       840
     tccctcctgc ccggcttcga agcggggtac ttgcacgccc cggccgtcgc cgggcgctac       900
     ccgctggagg aggccgcaga ggcctacgcc cgggtcgaga gcggggaggc cgcagggcgg       960
     gtgctcctcg tcatggcccc ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page