(data stored in ACNUC7421 zone)

EMBL: CP000386.PE205

CP000386.PE205       Location/Qualifiers
FT   CDS_pept        209161..209850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0208"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   sma:SAV1619 putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03186"
FT                   /db_xref="GOA:Q1AZJ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ2"
FT                   /protein_id="ABG03186.1"
FT                   /translation="MRPGKMRRMGRDEKRAGSLSDVAYEKLYGDITGGRLQPNERLIEL
FT                   DIARELGVSRAAVRNALIRLEQEGLVKREPNRGARVRLVSEEEAVEILEARMALECVAV
FT                   RHAALNRTQEDIAGLREILSQMESRLEAGDLLGASDLNGQFHRRLVEISNHATISKLLK
FT                   MLNSQLIRFQYRTILTPGRPASSLAEHRAIFEAVEAGDPERAEQAMRRHLSGVTEALRR
FT                   AAAQEAR"
     atgaggcccg gtaaaatgcg tcggatggga cgagacgaga agcgggcggg ttctctgtcc        60
     gacgttgcgt acgagaagct ctacggcgac ataaccggcg ggaggctgca gccgaacgag       120
     cgcctgatcg agctggacat cgcccgcgag ctcggcgtga gccgggccgc cgtccggaac       180
     gcgctcatcc ggctggagca ggaggggctg gtgaagcgtg agccgaaccg gggggcgagg       240
     gtgcggctgg tctccgagga ggaggcggtg gagatcctgg aggcccggat ggccctagag       300
     tgcgtggccg tgcggcacgc cgccctgaac cgcacccagg aggacatcgc cgggctcagg       360
     gagatcctct cccagatgga gagccggctg gaggccggag acctgctggg cgcctccgac       420
     ctgaacggcc agttccaccg ccgcctcgtc gagatctcca accacgccac catctccaag       480
     ctgctgaaga tgcttaactc ccagctcata aggttccagt accgtaccat cctcacccca       540
     ggccgtccgg ccagctcgct cgccgaacac agggccatct tcgaggccgt cgaggccggc       600
     gacccggaga gggcagaaca ggccatgcgc agacacctct ccggcgtgac ggaagccctc       660
     agacgagccg ccgcccaaga ggcccgctag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page