(data stored in ACNUC7421 zone)

EMBL: CP000386.PE207

CP000386.PE207       Location/Qualifiers
FT   CDS_pept        211342..211923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa21490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ0"
FT                   /protein_id="ABG03188.1"
FT                   /translation="MNRFEEQIYRCMEPVAELLEVTRDPHHRAILENYRLHVHLEGSGQ
FT                   YERIVAPDMMVEDPVYRINWGEPTVIRGREGVLDFYRSAGRYVMWNSEDRIAVADWGLC
FT                   DELTFNFLVTGEILGEFGVEVDDKEAYYHFKTRQAFVWPYDERARLIGEHLYVDETSAV
FT                   VTRVDESEVITPERAAEIHGELLERLEGGR"
     atgaacaggt tcgaggagca gatctaccgc tgcatggagc ccgtcgcgga gcttctcgag        60
     gtcacccggg acccccatca ccgggcgatc ctcgagaact accggctcca cgtgcacctc       120
     gaggggtcgg ggcagtacga gaggatagtg gccccggaca tgatggtcga ggatccggtc       180
     taccggatca actggggaga gccgacggtg atcaggggcc gggagggggt gctggacttc       240
     taccgcagcg ccggcaggta cgtcatgtgg aactcggagg acaggatcgc ggtggccgac       300
     tggggcctgt gcgacgagct gaccttcaac tttctggtca ccggcgagat cctgggggag       360
     ttcggcgtgg aggtggatga caaggaggcc tactaccact tcaagacccg ccaggccttc       420
     gtctggccgt acgacgagcg ggcccggctc atcggcgagc acctctacgt ggacgagacc       480
     agcgcggtcg tcaccagggt ggacgagagc gaggtgatca cgcccgagag agcggcggag       540
     atccacgggg agctcctgga gcgcctggag ggcgggaggt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page