(data stored in ACNUC7421 zone)

EMBL: CP000386.PE208

CP000386.PE208       Location/Qualifiers
FT   CDS_pept        complement(211945..212910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0211"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa43060
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03189"
FT                   /db_xref="GOA:Q1AZI9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI9"
FT                   /protein_id="ABG03189.1"
FT                   /translation="MAVKFGVFVPQGWRMDLTEIEDPAEQYEAMTRVARRADELDGYDS
FT                   IWVYDHFHTVPEPTRNTTFECWTITAGLARDTRRVKVGQMVTCNGYRNPALLAKMASTV
FT                   DVMSHGRLLFGLGAGWYEHEWRAYGYGFPDVPVRMRMFREACEIVHRMWTEDGAVFEGE
FT                   HYRIDRPINEPKGLQKPHPPFWIGGGGERVTLRLVARWGDACNVFGDPDTLRHKFGVLR
FT                   RHCEEVGRDYEEITRSTSVNVHLLEEGEDPEKATRRARGGRSYEEYAEQFRVGTPRQIV
FT                   SLLEERAEAGVEYFIVYLPRVAYDHTQLERFAEEVIPALS"
     gtggctgtga aattcggcgt cttcgtgccc caggggtggc ggatggacct caccgagata        60
     gaggatcccg ccgagcagta cgaggcgatg acccgggtgg cccggcgggc cgacgagctg       120
     gacggctacg actccatatg ggtctacgac cacttccaca ccgtcccgga gcccaccagg       180
     aacaccacct tcgagtgctg gacgataacc gcgggcctgg cgcgcgacac ccggcgggtg       240
     aaggtggggc agatggtcac ctgcaacggc taccgcaacc ccgcgctgct ggccaagatg       300
     gcctcaacgg tggacgtgat gagccacggg cggctcctgt tcgggctcgg ggcgggctgg       360
     tacgagcacg agtggcgggc ctacggctac ggcttccccg acgtgccggt gaggatgcgc       420
     atgttccggg aggcctgcga gatagtccac cggatgtgga ccgaggacgg cgcggtcttc       480
     gagggggagc actaccggat agaccggccc ataaacgagc ccaagggcct gcagaagccg       540
     cacccgccgt tctggatcgg gggcggcggc gagagggtaa ccctgcggct cgtcgcccgc       600
     tggggcgacg cctgcaacgt cttcggcgac cccgacaccc tgcggcacaa gttcggggtg       660
     ctcaggcgcc actgcgagga ggtgggcagg gactacgagg agatcacccg ctccacctcc       720
     gtgaacgtac acctcctgga ggagggcgag gacccggaga aggccacccg gcgggcccgc       780
     ggcgggcgca gctacgagga gtacgccgag cagttcaggg tcgggacccc gaggcagatc       840
     gtctcgctgc tcgaggagcg ggcggaggcc ggcgtggagt actttatcgt gtacctcccg       900
     cgggtggcct acgaccacac ccagctcgag cggttcgcgg aggaggtgat cccggcgctc       960
     tcctag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page