(data stored in ACNUC7421 zone)

EMBL: CP000386.PE214

CP000386.PE214       Location/Qualifiers
FT   CDS_pept        218740..219744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0217"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: sme:SMb20100 putative
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03195"
FT                   /db_xref="GOA:Q1AZI3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI3"
FT                   /protein_id="ABG03195.1"
FT                   /translation="MKITGTVGYAAMFEQFHPTDLLRWSRLAEENGFASVMASDHFHPW
FT                   TPEQGQSAFVWSWLGALGATTSLRFGTGVTPPGFRYHPAVIAQAAATLEAMYPGRFWLG
FT                   LGAGEALNEHIVGRYWPEAPTRLRILMESIEVIRRLFTGKKVKYQGEHVTLESARLYTL
FT                   PETPPPIYVATAGPIQSKRTGKYCDGIITVGASDEKIGMLMERFEEGAREAGKDPSQMP
FT                   RIVQLHVSWAESREEAEENALKEWPNGGMPFPKGDIRNPEDFQAMARFVRPEDFENRVL
FT                   ISADLDEHLEHVQHYIDLGFDEVYVHNVGRNQEEFIRAYGERVIPKLRWPEEG"
     atgaagatta cgggcacggt cgggtacgcg gcgatgttcg agcagttcca cccaacggac        60
     ctgctgcggt ggagcaggct cgccgaggag aacggcttcg cctccgtgat ggcctcggac       120
     cacttccacc cctggacccc ggagcagggc cagagcgcct tcgtctggag ctggctcggg       180
     gccctcgggg cgacgacctc cctgcgcttc gggaccggcg tcaccccgcc ggggttccgg       240
     taccacccgg cggtcatcgc gcaggccgcc gccacgctgg aggcgatgta cccggggcgg       300
     ttctggctgg ggctgggggc gggcgaggcc ctcaacgagc acatcgtcgg gcgctactgg       360
     cccgaggcgc ccacgcggct gcgcatcctc atggagtcca tcgaggtcat aaggaggctc       420
     ttcaccggca agaaggtcaa gtaccagggg gagcacgtaa cgctcgagag cgcgcggctc       480
     tacacgctgc ccgagacgcc gccccccatc tacgtagcga ccgcggggcc gatccagagc       540
     aagaggaccg gcaagtactg cgacgggatc atcaccgtcg gcgcctccga cgagaagata       600
     gggatgctca tggagcgctt cgaggagggc gcccgcgagg cggggaagga cccctcccag       660
     atgccgcgca tcgtccagct acacgtctcc tgggcggaga gccgggagga ggcggaggag       720
     aacgcgctca aggagtggcc caacggcggc atgcccttcc cgaagggcga catccgcaac       780
     cccgaggact tccaggcgat ggcccgcttc gtccggccgg aggacttcga gaaccgcgtg       840
     ctcatcagcg ccgacctcga cgagcacctg gagcacgtcc agcactacat agacctgggc       900
     ttcgacgagg tctacgtcca caacgtcggg cgcaaccagg aggagttcat aagggcctac       960
     ggggagcgtg tgatcccgaa gctgcgctgg ccggaggagg ggtag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page