(data stored in ACNUC7421 zone)

EMBL: CP000386.PE215

CP000386.PE215       Location/Qualifiers
FT   CDS_pept        219746..220690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0218"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcl:ABC3060 drug/metabolite
FT                   transporter (DMT) superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03196"
FT                   /db_xref="GOA:Q1AZI2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI2"
FT                   /protein_id="ABG03196.1"
FT                   /translation="MAWRKGGFFGVLLVALGASLWGTDGVLRVPLLEDMSPLSIVFAEH
FT                   LFLAAYSVPAVVIGRRAFRGFGLPQWGALLVIGWGGSALATLLFTAAFAVGNPTVVILL
FT                   QKTQPLFAIALSALLLREPLGWRYWPGFAVAMVGAYLVSFADLSPFRQLPGAEALTAAL
FT                   ALGAALLWGSSTVLGRLVLREVPFHTLTGARLLLALPLLAGIVLAQGTLGQAAQGLAGH
FT                   PGRLALLALLPGLLALLLYYRGLSSTRASYATLAELTFPATAVVLNWAVLGVGIGASQL
FT                   AGFLLLWGAVLYLSHLNARSPSPEGPALEPGRG"
     ttggcctgga ggaagggcgg cttcttcggc gttttgctgg ttgccctcgg cgcctcgctg        60
     tggggcaccg acggggtgct ccgggtcccg ctgctcgagg acatgtcgcc gctctccata       120
     gtcttcgccg agcacctgtt tctggcggcc tactccgtgc ccgccgtcgt catcgggcgc       180
     cgcgccttcc ggggcttcgg cctcccgcag tggggggcgc tgctcgtgat cgggtggggc       240
     ggctccgccc tggccacgct gctcttcacc gcggccttcg ccgtcggcaa ccccacggtc       300
     gtcatcctcc tgcagaagac ccagccgctc ttcgccatag ccctctccgc ccttctgctc       360
     cgggagccgc tgggctggag gtactggccc ggcttcgccg tggccatggt cggggcctac       420
     ctggtctcct tcgcggacct ctcgccgttc cggcagctgc cgggcgccga ggcgctgacc       480
     gccgccctcg cgctcggagc cgccctgctg tggggctcct cgaccgtgct ggggcggctg       540
     gtgctccggg aggtcccctt ccacaccctc accggggcgc gcctcctcct cgccctgccg       600
     ctgctcgccg gcatagtgct cgcccagggc accctcgggc aggcggcgca ggggctcgcc       660
     ggccacccgg gccggctcgc gctgctcgcc ctcctccccg gccttctcgc cctcctcctc       720
     tactaccggg ggctctcctc cacccgggcc tcctacgcca ccctcgccga gctcaccttc       780
     cccgccaccg cggtcgtcct caactgggcg gtgctcgggg tggggatagg cgccagccag       840
     ctggccggct ttctcctgct ctggggggcc gtgctctacc tcagccacct caacgcccgc       900
     tccccctctc cggagggccc cgcactcgag cccgggcggg gttga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page