(data stored in ACNUC7421 zone)

EMBL: CP000386.PE223

CP000386.PE223       Location/Qualifiers
FT   CDS_pept        230710..231498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0226"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: mta:Moth_0708
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03204"
FT                   /db_xref="GOA:Q1AZH4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH4"
FT                   /protein_id="ABG03204.1"
FT                   /translation="MSRMDPYLYLDRDTPVHRLDPRAKMFLLLGAFVLAFLFPDPLYGL
FT                   GVLGLVLCFGHAARSLANLRRIWFILAMIAVMTVLLWSVFGGGRTPLLWFVELEPVLYG
FT                   LGTALRIDNTIIAGMIFLSTTRNEEIATGLVRLGIPYRFAFAVSTALRLVPTIIATGST
FT                   IGQAQRSRGLDLDSGGVIQRVRKRIPLLVPVFVSTIRSTSVFSMALESKGFGVAPRRTY
FT                   FLQLSVRRGDVVAMAVMAVLVAGAVALRLAGYGGVEGFSR"
     atgagccgga tggaccccta cctctacctc gaccgcgaca ccccggtgca ccggctcgac        60
     ccgcgcgcca agatgttcct gctgctcggg gccttcgtgc tggcgttcct gttcccggac       120
     cccctctacg ggctcggggt gctggggctg gtgctgtgct tcgggcacgc cgcgaggtcg       180
     ctcgcgaacc tccggcgcat ctggttcatc ctcgccatga tcgccgtgat gaccgtcttg       240
     ctgtggtccg tgttcggcgg cgggcggacc ccgctcctct ggttcgtgga gctagagccc       300
     gtgctctacg gcctcgggac cgccctcagg atagacaaca ccattatcgc gggcatgatc       360
     ttcctctcca ccacccgcaa cgaggagata gccaccggcc tggtccggct cggcatcccc       420
     taccgcttcg ccttcgccgt ctccaccgcc ctccggctcg tccccaccat aatcgcgacc       480
     gggtccacca tcgggcaggc ccagcgctcc cgggggctcg atctggactc cgggggcgtg       540
     atccaacgcg tgcgcaagcg catccccctg ctcgtgccgg tctttgtctc caccatccgc       600
     tccaccagcg tgttcagcat ggccctggag tccaaggggt tcggggtcgc gccgcgccgg       660
     acctacttcc tgcagctctc cgtgcggcgc ggggacgtgg tggcgatggc ggtgatggcg       720
     gtgctcgtcg cgggggccgt ggcgctgcgg ctggccgggt acgggggcgt ggaagggttc       780
     agcaggtag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page